Conserved Protein Domain Family
F-BAR_srGAP3

?
cd07684: F-BAR_srGAP3 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Protein 3
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Slit-Robo GTPase Activating Proteins (srGAPs) are Rho GAPs that interact with Robo1, the transmembrane receptor of Slit proteins. Slit proteins are secreted proteins that control axon guidance and the migration of neurons and leukocytes. Vertebrates contain three isoforms of srGAPs. srGAP3, also called MEGAP (MEntal disorder associated GTPase-Activating Protein), is a Rho GAP with activity towards Rac1 and Cdc42. It impacts cell migration by regulating actin and microtubule cytoskeletal dynamics. The association between srGAP3 haploinsufficiency and mental retardation is under debate. srGAP3 contains an N-terminal F-BAR domain, a Rho GAP domain, and a C-terminal SH3 domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153368
View PSSM: cd07684
Aligned: 3 rows
Threshold Bit Score: 485.363
Threshold Setting Gi: 47229761
Created: 17-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human FCHO2, human Pacsin1 and human Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #  #      #  ##  #  ##  ##  #   #  #   #                                   
Q812A2         26 TQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRSSREHQFKKdqyl-lspvNCWYLVLH 104  house mouse
CAG06957        8 NQLVEQFRCLEQQSESRLQLLQDLQEFFRRKAELQLEYSRGLEKLAERYSAKIRTSREHQHLKkdqnlmstvNCWYLVLE 87   spotted green...
NP_001025775   26 TQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKLAERFSSKIRGSREHQFKKdqhl-lspvNCWYLVLT 104  chicken
Feature 1             #  #                                                                        
Q812A2        105 QTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESKLKEA 184  house mouse
CAG06957       88 QTRRESKDHATLSDIYNNNVIVRLAHVGEDVIRLFKKSKDIGVQMHEELVKVTNELYTVMKTYHMYHTESLSAENKLKEA 167  spotted green...
NP_001025775  105 QTRRESRDHATLNDIFTNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESKLKEA 184  chicken
Feature 1                                      #   #                        #   #  #  ##  #   #  #
Q812A2        185 EKQEEKQFNKsgELSMNLLR--HEDRPQRRSSVKKIEKMKEKRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDV 262  house mouse
CAG06957      168 ERQEEKHIGKanDISSALLRygHDERPQRRSSVKKMEKMKEKRQAKYYENKLKCTKARNDYLLNLAATNALVAKYYIHDV 247  spotted green...
NP_001025775  185 EKQEEKQFNKsgDVSVNLLR--HEERPQRRSSVKKIEKMKEKRQAKYSENKLKCTKARNDYLLNLAATNAAVSKYYIHDV 262  chicken
Feature 1            #   #  ##  # 
Q812A2        263 SDLIDCCDLGFHASLA 278  house mouse
CAG06957      248 SDMIDCCDLGYHASLA 263  spotted green pufferfish
NP_001025775  263 SDLIDCCDLGFHASLA 278  chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap