Conserved Protein Domain Family
F-BAR_srGAP1

?
cd07683: F-BAR_srGAP1 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Protein 1
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Slit-Robo GTPase Activating Proteins (srGAPs) are Rho GAPs that interact with Robo1, the transmembrane receptor of Slit proteins. Slit proteins are secreted proteins that control axon guidance and the migration of neurons and leukocytes. Vertebrates contain three isoforms of srGAPs. srGAP1, also called Rho GTPase-Activating Protein 13 (ARHGAP13), is a Cdc42- and RhoA-specific GAP and is expressed later in the development of CNS (central nervous system) tissues. It is an important downstream signaling molecule of Robo1. srGAP1 contains an N-terminal F-BAR domain, a Rho GAP domain, and a C-terminal SH3 domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153367
View PSSM: cd07683
Aligned: 3 rows
Threshold Bit Score: 488.807
Threshold Setting Gi: 71834354
Created: 17-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human FCHO2, human Pacsin1 and human Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #  #      #  ##  #  ##  ##  #   #  #   #                                   
Q91Z69         26 AQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERFMAKTRSTKDHQQFKKDQNLLSPVNCWYLLLN 105  house mouse
NP_001025266   26 SQLVEQQKCLEQQTDMRVQLLQDLQDFFRKKAEIESEYSRNLEKLAERFMAKTRSTKDHQQYKKDQNLLSPVNCWYLLLN 105  zebrafish
NP_001073570   26 AQLIEQQKCLEQQTEMRVQLLQDLQDFFRKKSEIEMEYSRNLEKLAERFMAKTRSTKDHQQYKKDQNLLSPVNCWYLLLN 105  chicken
Feature 1             #  #                                                                        
Q91Z69        106 QVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHSESISAESKLKEA 185  house mouse
NP_001025266  106 QVRRESKDHATLSDLYLNNVITRFTHVSEDNMRLLKKSKEIIFQLQEDLMKILNELYTVMKTYHMYHTETLSAENKLKEA 185  zebrafish
NP_001073570  106 QVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAESKLKEA 185  chicken
Feature 1                                   #   #                        #   #  #  ##  #   #  #   
Q91Z69        186 EKQEEKQiGRSGDPVFHIRLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDLSDL 265  house mouse
NP_001025266  186 ERQGERQ-GRGGEAVFSLRTEDRHQRRNAARKIQKMKEKRQAKYSENKLKVMKARNEYLLTLEATNASLFKYYIHDLSHL 264  zebrafish
NP_001073570  186 EKQEEKQiGRSGDPVFHIRLEDRHQRRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDLSDL 265  chicken
Feature 1         #   #  ##  # 
Q91Z69        266 IDCCDLGYHASLN 278  house mouse
NP_001025266  265 TDCCDLGYHAGLS 277  zebrafish
NP_001073570  266 IDCCDLGYHASLN 278  chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap