Conserved Protein Domain Family
F-BAR_srGAP2

?
cd07682: F-BAR_srGAP2 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Protein 2
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Slit-Robo GTPase Activating Proteins (srGAPs) are Rho GAPs that interact with Robo1, the transmembrane receptor of Slit proteins. Slit proteins are secreted proteins that control axon guidance and the migration of neurons and leukocytes. Vertebrates contain three isoforms of srGAPs. srGAP2 is expressed in zones of neuronal differentiation. It plays a role in the regeneration of neurons and axons. srGAP2 contains an N-terminal F-BAR domain, a Rho GAP domain, and a C-terminal SH3 domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153366
View PSSM: cd07682
Aligned: 4 rows
Threshold Bit Score: 527.338
Threshold Setting Gi: 118102419
Created: 17-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human FCHO2, human Pacsin1 and human Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #  #      #  ##  #  ##  ##  #   #  #   #                                   
O75044         26 AQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQ 105  human
NP_001041700   26 AQLVEQLKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTRYTKDPQFKKEQNILSPVNCWNLLLAQ 105  zebrafish
XP_417972      26 AQLVEQLKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQ 105  chicken
NP_001087899   26 AQLIEQLKCLDQQCDLRTQLLQDLQDFFRKKAEIEMDYSRNLEKLTERFLSKTRGAKDQQFKKDQNVLSPVNCWNLLLTQ 105  African clawe...
Feature 1            #  #                                                                         
O75044        106 VKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAE 185  human
NP_001041700  106 VKRESRDHATLSDLYLNNIIPRFAQISEDSGRLFKKSKEVGLQLQEDLMKVLNELYTVMKTYHMYNMDSINAESKLKEAE 185  zebrafish
XP_417972     106 VKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGLQLQEDLIKVLNELYTVMKTYHMYNADSISAQSKLKEAE 185  chicken
NP_001087899  106 VKRESRDHATLSDIYLNNIIPRFGQISEDSGRLFKKSKEIGLQLQEDMMKVLNELYTVMKTYHMYNADSISAQSKLKEAE 185  African clawe...
Feature 1                                             #   #                        #   #  #  ##  #
O75044        186 KQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLALEATNASVF 265  human
NP_001041700  186 KQEEKQMSRSVRHEEKQTPRSPDSLTNIKIEDKHVRRSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLALEATNSCVF 265  zebrafish
XP_417972     186 KQEEKQIGKSVKQEEKQTPRSPDSTSNVKFEEKHVRRSSVKKIEKMKEKRQAKYTENRLKAIKARNEYLLALEATNASVF 265  chicken
NP_001087899  186 KQEEKQMSRSVRQEDRQTPRSPDTATSIRLEEKHIRRSSVRKIEKMKEKRQAKYTENKVKAIKARNEYVLALEATNASVF 265  African clawe...
Feature 1            #  #    #   #  ##  # 
O75044        266 KYYIHDLSDLiDQCCDLGYHASLN 289  human
NP_001041700  266 KYYIHDLSDL-IDCCDLGYHASLN 288  zebrafish
XP_417972     266 KYYIHDLSDL-IDCCDLGYHASLN 288  chicken
NP_001087899  266 KYYIHDLSDL-INCCDLGYHSSLH 288  African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap