Conserved Protein Domain Family
F-BAR_PACSIN3

?
cd07681: F-BAR_PACSIN3 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3)
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins, also called Synaptic dynamin-associated proteins (Syndapins), act as regulators of cytoskeletal and membrane dynamics. Vetebrates harbor three isoforms with distinct expression patterns and specific functions. PACSIN 3 or Syndapin III is expressed ubiquitously and regulates glucose uptake in adipocytes through its role in GLUT1 trafficking. It also modulates the subcellular localization and stimulus-specific function of the cation channel TRPV4. PACSIN 3 contains an N-terminal F-BAR domain and a C-terminal SH3 domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153365
View PSSM: cd07681
Aligned: 4 rows
Threshold Bit Score: 468.263
Threshold Setting Gi: 119588367
Created: 17-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interfaceputative
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human Pacsin1 and Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        ###     ##  #  #  ##  ## ##  ##  ## ##  ##  #  ##                #  #  #       #
EAW67961      16 FWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADWARKWRGTVEKgpqygtlekAWHAFFTAAERLSALH 95  human
NP_001038117  16 FWEAGNYRRTVKRVDDGYRLCNDLISCFQERAKIEKNYAQQLTEWSRKWRTNVEKgpqygtlekAWHAFLTAADKLSEIH 95  chicken
NP_957283     16 FWEPGNYKRTVKRIDDGYKLCNELVSCFQERAKIEKGYSQQLSDWARKWRGIVEKgsqygtlekAWHAFMNAADRLSEIH 95  zebrafish
NP_001086374  15 FWEAGNYRSTVKRIEDGNRLCNDLVSCFRERAKIEKSYAQQLSDWSNKWRNSLEKgpqygtlekSWQAFLTGAEKLSEIH 94  African clawed ...
Feature 1                                                       #   #                            
EAW67961      96 LEVREKLQGQDSERVRAWQRGAFHrpvlgGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHAARKDEKTAQTREsHAK 175 human
NP_001038117  96 LVVRNHLAGEDSDKIKAWQKEAYHkqiigGFKETKEAEDGFRKAQKPWVKKMKDVETSKKNYHAARKEEKTAHTREnHAK 175 chicken
NP_957283     96 MELKENLVIEDSEKIRNWQKDAFHkqmigGFRETKDADEGFRKAQKPWVRKLKEVESTKKGYHSARKEERTALTREtHAK 175 zebrafish
NP_001086374  95 TELRNQIWDEDSGKVRDWQKEAFHkqmigGFRESKEAEESFSKAQKPWVKKLKDVEVAKKRYHVARKDERSAQVREdHSK 174 African clawed ...
Feature 1                                          #              #  #   #  ## ##   #  ## ##  ###
EAW67961     176 ADSAVSQEQLRKLQERVERCAKEAEKTKAQYEQTLAELHRYTPRYMEDMEQAFETCQAAERQRLLFFKDMLLTLHQHLDL 255 human
NP_001038117 176 ADSSVSQEQLRKLQERVEKCTQEAEKCKDQYEKMLEELNRYNPRYMEDMEQVFEGCQEAERKRLCFFKEMFLNLHQHLNL 255 chicken
NP_957283    176 ADPTKSQDEVRKFTDRLEKCTQEAEKAKERYERALDELNRCNPRYMEDMEQVFEITQEAEKNRLCFFKEVLLDIHQHMDL 255 zebrafish
NP_001086374 175 ADSTVSQEQLRKLQDRVEKCNQEVEKNKGLYEKALEELNRYNPRYMEDMEQAFESCQEAEQKRLSFFKEMLLDFHKHLDL 254 African clawed ...
Feature 1        #    ##  #  ##  ##
EAW67961     256 SSSEKFHELHRDLHQGIE 273 human
NP_001038117 256 STSESFQALYRDLYQVIM 273 chicken
NP_957283    256 SSNDRFRALYRDLGQTIS 273 zebrafish
NP_001086374 255 SSKDSFHVLYKDLHQSIQ 272 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap