3HAI,3HAH


Conserved Protein Domain Family
F-BAR_PACSIN1

?
cd07680: F-BAR_PACSIN1 
Click on image for an interactive view with Cn3D
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1)
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins, also called Synaptic dynamin-associated proteins (Syndapins), act as regulators of cytoskeletal and membrane dynamics. Vetebrates harbor three isoforms with distinct expression patterns and specific functions. PACSIN 1 or Syndapin I is expressed specifically in the brain and is localized in neurites and synaptic boutons. It binds the brain-specific proteins dynamin I, synaptojanin, synapsin I, and neural Wiskott-Aldrich syndrome protein (nWASP), and functions as a link between the cytoskeletal machinery and synaptic vesicle endocytosis. PACSIN 1 interacts with huntingtin and may be implicated in the neuropathology of Huntington's disease. It contains an N-terminal F-BAR domain and a C-terminal SH3 domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153364
View PSSM: cd07680
Aligned: 6 rows
Threshold Bit Score: 496.491
Threshold Setting Gi: 240104573
Created: 17-Jun-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 64 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:3HAI_AB; interface between monomers in human Pacsin1 F-BAR dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        ###     ##  #  #  ##  ## ##  ##  ## ##  ##  #  ##                #  #  #       #
3HAI_A        19 FWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKgpqygsleRAWGAIMTEADKVSELH 98  human
XP_418028     19 FWEVGNYKRTVKRIDDGHRLCNDLMNCVHERAKIEKSYAQQLTDWSKRWRQLIEKgpqygsleRAWGAIMTEADKVSELH 98  chicken
NP_001028900  18 FWEVGNYKRTVKRIEDGHRLCNDMMSCIQERAKIEKAYSQQLTDWSKRWRQLVERgpqygtleRAWLAVMTEAEKVSELH 97  zebrafish
NP_001087407  18 FWEVGHYKRTVKRIDDGHRLCNDLMGCLQDRAKIEKAYSQQLTDWAKRWRQLIEKgpqygtleRAWGALLTEAEKAGELH 97  African clawed ...
Q5R411        19 FWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKgpqygsleRAWGAIMTEADKVSELH 98  Sumatran orangutan
3HAH_A        19 FWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKgpqygsleRAWGAIMTEADKVSELH 98  human
Feature 1                                                       #   #      #  ##  ##             
3HAI_A        99 QEVKNNLLNEDLEKVKNWQKDAYHKQimgGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSK 178 human
XP_418028     99 QEVKNSLLNDDFEKVKNWQKDAYHKQimgGFKEAKEAEDGFRKAQKPWAKKLKELETAKKAYHLACKEEKLAMTREANSK 178 chicken
NP_001028900  98 QEVKNNLLNEDLEKVKNWQKDAYHKQmmgGFKETKEADEGFRKAQKPWAKKLKELETAKKTYHMACKEEKIASAREANSK 177 zebrafish
NP_001087407  98 QEVRNHLVSEDMEKVRNWQKETYHKQmmgGFKESREAEEGFRKAQKPWAKKIKEVEAAKKTYHMACKEEKLASSREASGK 177 African clawed ...
Q5R411        99 QEVKNNLLNEDLEKVKNWQKDAYHKQimgGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSK 178 Sumatran orangutan
3HAH_A        99 QEVKNNLLNEDLEKVKNWQKDAYHKQimgGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSK 178 human
Feature 1                                      #   #          #   #  #   #  ## ##  ##  ## ##  ###
3HAI_A       179 TEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNL 258 human
XP_418028    179 ADQSNTPEQQKKLQDKVEKCKQDVQKTQEKYEKVLDELNKCTPQYMESMEQVFEQCQQFEEKRLNFLKEVLLDIKRHLNL 258 chicken
NP_001028900 178 GEASVTTDQQKKLQEKVDKCKNDVQKAKEKYEKSLDELNKCTPQYMENMEVVFDQCQQFEEKRLNFLREVLLDTKRHLNL 257 zebrafish
NP_001087407 178 ADASVTADQLRKLQDKVEKCKQDVQKAQERYEKILDDIQKSTPQYMESMDLVFEQCQQMEEKRLVFLKEILLDIKHHLNL 257 African clawed ...
Q5R411       179 SEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNL 258 Sumatran orangutan
3HAH_A       179 TEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNL 258 human
Feature 1        ##   ##  ## ##  ##
3HAI_A       259 AENSSYIHVYRELEQAIR 276 human
XP_418028    259 AESSSYANVYRELEQTIR 276 chicken
NP_001028900 258 TESQSYATVYRELERTIV 275 zebrafish
NP_001087407 258 AESSSYAAVYQELEQTIQ 275 African clawed frog
Q5R411       259 AENSSYIHVYRELEQAIR 276 Sumatran orangutan
3HAH_A       259 AENSSYIHVYRELEQAIR 276 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap