3HAJ


Conserved Protein Domain Family
F-BAR_PACSIN2

?
cd07679: F-BAR_PACSIN2 
Click on image for an interactive view with Cn3D
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 2 (PACSIN2)
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins, also called Synaptic dynamin-associated proteins (Syndapins), act as regulators of cytoskeletal and membrane dynamics. Vetebrates harbor three isoforms with distinct expression patterns and specific functions. PACSIN 2 or Syndapin II is expressed ubiquitously and is involved in the regulation of tubulin polymerization. It associates with Golgi membranes and forms a complex with dynamin II which is crucial in promoting vesicle formation from the trans-Golgi network. PACSIN 2 contains an N-terminal F-BAR domain and a C-terminal SH3 domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153363
View PSSM: cd07679
Aligned: 5 rows
Threshold Bit Score: 502.673
Threshold Setting Gi: 46309505
Created: 17-Jun-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 59 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:3HAJ_AB; interface between monomers in human Pacsin2 F-BAR dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1     ###     ##  #  #  ##  ## ##  ##  ## ##  ##  #  ##       ##   #   #  ## #       #
3HAJ_A     18 FWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKgPQYGTVEKAWMAFMSEAERVSELH 97  human
AAI28666   18 FWEVGNYKRTVKRIDDGHRLCNDLMNCIHERARIEKVYAQQLTEWAKRWKQLVERgPQYGTVEKAWHNLMTEAEKVSELH 97  African clawed frog
NP_990420  18 FWEVGNYKRTVKRIDDGHRLCNDLMNCIHERARIEKVYAQQLTEWAKRWKQLVEKgPQYGTVERAWCAFMSEAEKVSELH 97  chicken
NP_996952  16 FWEVGNYKRSVKRVDDGNRLCNDLMSCLHERARIEKSYSTQLTDWAKRWRQTIEKgPQYGTVERAWCALMTEAEKVSDLH 95  zebrafish
Q9QY17     18 FWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKgPQYGTVEKAWMAVMSEAERVSELH 97  Norway rat
Feature 1                                                    #   #                            
3HAJ_A     98 LEVKASLMNDDFEKIKNWQKEAFHKQMMgGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREaNSK 177 human
AAI28666   98 HEVKNALMNEDFEKIKNWQKEAFHKQMIgGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKTYHTACKEEKLATSREaNSK 177 African clawed frog
NP_990420  98 LEVKGSLMNEDFEKIKNWQKEAFHKQMMgGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAYHAACKEEKLAISREtNSK 177 chicken
NP_996952  96 MEVKAALMAEDFEKIKNWQKDAYHKQIIgGFKETKEAEDGFRKAQKPWAKKLKEMETMKKAYHTACKEEKTATSRE-NSS 174 zebrafish
Q9QY17     98 LEVKASLMNEDFEKIKNWQKEAFHKQMMgGFKETKEAEDGFRKAQKPWAKKLKEVDAAKKAHHTACKEEKLAVSREaNSK 177 Norway rat
Feature 1                                       #              #  #   #  ## ###  #  ## ##  ###
3HAJ_A    178 ADPSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDL 257 human
AAI28666  178 ADPAMNPEQLKKLQDKVEKSKQDSQKTKEKYEKALKDLDGTTPQYMENMEQVFEQCQQFEDKRLSFFREVLLEVEKHLDL 257 African clawed frog
NP_990420 178 ADPALNPEQLKKLQDKVERSKQDVLKTKAKYEKSLKELDNATPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDL 257 chicken
NP_996952 175 KLDNSNPEAQKKLQEKVEKCQQEVQKTKERYEKSLEDLDKVTPQYMENMEQVFEQWQQFEGKRLSFFKEVLLEVKQHLDL 254 zebrafish
Q9QY17    178 ADPSLNPEQLKKLQDKIEKCKQDVLKTKDKYEKALKELDQTTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDL 257 Norway rat
Feature 1     #    ##  #  ##  ##
3HAJ_A    258 SNVAGYKAIYHDLEQSIR 275 human
AAI28666  258 SNVDSYANIYRELEYSIK 275 African clawed frog
NP_990420 258 SNVASYKNIYRELEQNIK 275 chicken
NP_996952 255 SSNHKYTTVYHTLQDTIQ 272 zebrafish
Q9QY17    258 SNVASYKGIYRELEQSIK 275 Norway rat

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap