Conserved Protein Domain Family
F-BAR_FCHSD1

?
cd07678: F-BAR_FCHSD1 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH and double SH3 domains 1 (FCHSD1)
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. FCH and double SH3 domains 1 (FCHSD1) contains an N-terminal F-BAR domain and two SH3 domains at the C-terminus. It has been characterized only in silico, and its biological function is still unknown. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153362
View PSSM: cd07678
Aligned: 3 rows
Threshold Bit Score: 434.05
Threshold Setting Gi: 74714119
Created: 19-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human FCHO2, human Pacsin1 and human Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          #  #      #  ##  #  ##  ##  #   #  #   #                               #  #
Q86WN1     16 LRFLEQLSILQTWQQREADLLEDIRSYSKQRAAIEREYGQALQKLAGPFLKREghrsg---emdsrGRTVFGAWRCLLDA 92  human
AAH68909   23 VRFGEQLSSLQNKQLQDTELLEDIRSFCKQRAAVEKEYGQALQRLASQYLKRDwhrgknetsecrsVYSVWRSVVEGTAS 102 African clawed frog
XP_425188  92 LHFAEQLCGLQSKQQRDAELLEDIRSYSKQRAAIEREYGQALQRLASQFVKRDwqrgrsdagdsrsVFAVWKGIIEGTAY 171 chicken
Feature 1                                                                                     
Q86WN1     93 TVAGGQTRLQASDRYRDLAGGTGRSAKEQVLRKGTENLQRAQAEVLQSVRELSRSRKLYGQRERVWALAQEKAADVQARL 172 human
AAH68909  103 IGQTRVTSAENYRNLTSEAAKTARSAKELLLKKSIEQLLKVQNELLETMKEVNKTKKRYVQLERVSEVAKEKAMDTEARL 182 African clawed frog
XP_425188 172 TGQARVTASESYRSLAAEATKSSRLSKERMLKKSMEQLQKAQAELLETVKELDKAKKQFSHLQRSSEVAKDKAADVEARL 251 chicken
Feature 1                          #   #                        #    #  #  ##  #   #  #   #   
Q86WN1    173 NRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLQAARNEYLLNLVATNAHLDHYYQEELPALLKALVSELSEHLRDPLTSL 252 human
AAH68909  183 KKSEHSIFHSKASLQKLSAKFSTQLVEYNQQFSEARNEYLMALAAANAHLNHYYQTHLPDIMTCLDGDIYDRLRDYLTLI 262 African clawed frog
XP_425188 252 RKSDRRIFHTKASLQKLSAKFSMQMAEYSKQQAGVQNEYVLMLVSANAHLEHYYHVELPAIMQALDGDLYERLRDHLSTA 331 chicken
Feature 1     #  ##  #               
Q86WN1    253 SHTELEAAEVILEHAHRGEQTTS 275 human
AAH68909  263 SNTELNTCKFTQERFKDILVASQ 285 African clawed frog
XP_425188 332 GRAEVESCEITQDWFQRISEAAT 354 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap