Conserved Protein Domain Family
F-BAR_FCHSD2

?
cd07677: F-BAR_FCHSD2 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH and double SH3 domains 2 (FCHSD2)
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. FCH and double SH3 domains 2 (FCHSD2) contains an N-terminal F-BAR domain and two SH3 domains at the C-terminus. It has been characterized only in silico, and its biological function is still unknown. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153361
View PSSM: cd07677
Aligned: 3 rows
Threshold Bit Score: 497.729
Threshold Setting Gi: 156717230
Created: 19-Jun-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human FCHO2, human Pacsin1 and human Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #      #  ##  #  ##  ##  #   #  #   #                                #  
NP_055639     16 NIQVEQMTKLQAKHQAECDLLEDMRTFSQKKAAIEREYAQGMQKLASQYLKRDwpgvkaddrndyrsMYPVWKSFLEGTM 95  human
XP_417258     11 NIQVEQMTKLQAKHQAECELLEDIRAFSQKRAAIEKEYAQSIQKLASQYLKKDwlgmkaderadyrsMYSVWKSLLEGTM 90  chicken
NP_001096157   6 AKHQAECDLLEDMRTFSQKKAAVEREYAQTIQKLASQYLKKEWPAVKPDERSEyr-----------sIYTVWKSFLEGTM 74  western clawed ...
Feature 1        #                                                                               
NP_055639     96 QVAQSRMNICENYKNFISEPARTVRSLKEQQLKRCVDQLTKIQTELQETVKDLAKGKKKYFETEQMAHAVREKADIEAKS 175 human
XP_417258     91 QVAQSRLNICENYKNLISEPARTVRCFKEQQLKKYVDQLTRIQAELQETVKDLAKGKKKYFETEQMAQAVREKADIEAKS 170 chicken
NP_001096157  75 QVTQSQINICENYKNLISEPARTVKLYKEQQLKRCVDQLTKIQAELQETVKDLAKAKKKYYEAEQMAHAMREKADIDAKS 154 western clawed ...
Feature 1                          #   #                        #    #  #  ##  #   #  #   #   #  
NP_055639    176 KLSLFQSRISLQKASVKLKARRSECNSKATHARNDYLLTLAAANAHQDRYYQTDLVNIMKALDGNVYDHLKDYLIAFSRT 255 human
XP_417258    171 KLSLFQSRISLQKASVKLKARRSECNSKAIHARNDYLLTLAAANAHQDRYYQTDLVNIMKALDGNVYDHLKDYLMAFSRT 250 chicken
NP_001096157 155 KLSLFQSRISLQKANVKLKARRSECNAKATHARNDYLLTLAAANAHQDRYYQTDLANAMKALDGNVYDHLKDYLMALSRT 234 western clawed ...
Feature 1        ##  #               
NP_055639    256 ELETCQAVQNTFQFLLENSS 275 human
XP_417258    251 ELETCQAVQNTFQFLLETSS 270 chicken
NP_001096157 235 ELEKCQAVQNTFQYLLETSS 254 western clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap