2EFL


Conserved Protein Domain Family
F-BAR_FBP17

?
cd07676: F-BAR_FBP17 
Click on image for an interactive view with Cn3D
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 17
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Formin Binding Protein 17 (FBP17), also called FormiN Binding Protein 1 (FNBP1), is involved in dynamin-mediated endocytosis. It is recruited to clathrin-coated pits late in the endocytosis process and may play a role in the invagination and scission steps. FBP17 binds in vivo to tankyrase, a protein involved in telomere maintenance and mitogen activated protein kinase (MAPK) signaling. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153360
View PSSM: cd07676
Aligned: 4 rows
Threshold Bit Score: 469.527
Threshold Setting Gi: 149241439
Created: 16-Jun-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 31 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #      #  ##  #  ##  ##  #   #  #   #                              #  # 
2EFL_A        10 TELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKeeeeykytSCKAFISNLNEXNDYA 89  human
XP_415469      5 TELWDQFDNLEKHTQWGIDVLEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKeeeeyrytSTRAFLATLNEMNDYA 84  chicken
NP_001085826   5 TELWDQFDNLEKHTQWGIEVLEKYIKFVKERAEIESNYAKQLRNLSKKYQTKKNSKeeeeskytSCKAFQTTLNEMNDYA 84  African clawed ...
NP_001116716  22 TELWDQFDNLEKHTQWGIEFLERYTKFVKERSEIELSYAKQIRNLSKKYQLKKNSKeeeeykytTCRAFLMTLNELNDYA 101 zebrafish
Feature 1                                                                                        
2EFL_A        90 GQHEVISENXASQIIVDLARYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKXDADinv 169 human
XP_415469     85 GQHEVISENMTSLIIGELTRYVQELKQERKSHFHDGRKAQQHIETCWKQLEASKRRFERDCKEADRAQQYFEKMDADinv 164 chicken
NP_001085826  85 GQHEVISENAASLITVELTRFVQELKQERKQHFHEGRKAQQQIETCWKQLEASKRRFERDCKEAERAQQHFEKMDADinv 164 African clawed ...
NP_001116716 102 GQHEVIAENLSSQIIAELSRYTQELKAERKSHFHDGRRAQQHIENSWKQLESSKRRFERDCKEADRAQHYFDKMDADinv 181 zebrafish
Feature 1                              #   #                         #   #  #  ##  #   #  #   #  
2EFL_A       170 tKADVEKARQQAQIRHQXAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEXEERRIVRXGESXKTYAEVDRQVIPI 249 human
XP_415469    165 tKADVEKARQQAQLRHQMAEDSKAEYSSTLQKFNSEQHDHYYTHIPNIFQKIQEMEERRIVRIGESMKTFADVDRQVIPI 244 chicken
NP_001085826 165 tKADVEKARQQAQIRHQMSDDSKGDYSSVLQKFNREQHEHYFTHIPGIFQKLQDMEEKRIGRMGESLKTYADIDRQVVPI 244 African clawed ...
NP_001116716 182 tKADVEKAKQQAQMRHQIAEDSKNEYLTYLQKFNKDQHEHYYTLIPHIFQRIQEMEERRVGRVRESMRVYTEVERKVLPI 261 zebrafish
Feature 1         #  ##  #    
2EFL_A       250 IGKCLDGIVKAAE 262 human
XP_415469    245 IGKCLDEITKAAE 257 chicken
NP_001085826 245 IGKCLDGITKSAE 257 African clawed frog
NP_001116716 262 VSKCLDGMTKAAE 274 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap