Conserved Protein Domain Family
F-BAR_FNBP1L

?
cd07675: F-BAR_FNBP1L 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 1-Like
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. FormiN Binding Protein 1-Like (FNBP1L), also known as Toca-1 (Transducer of Cdc42-dependent actin assembly), forms a complex with neural Wiskott-Aldrich syndrome protein (N-WASP). The FNBP1L/N-WASP complex induces the formation of filopodia and endocytic vesicles. FNBP1L is required for Cdc42-induced actin assembly and is essential for autophagy of intracellular pathogens. It contains an N-terminal F-BAR domain, a central Cdc42-binding HR1 domain, and a C-terminal SH3 domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153359
View PSSM: cd07675
Aligned: 4 rows
Threshold Bit Score: 516.14
Threshold Setting Gi: 57525591
Created: 16-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interfaceputative
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #      #  ##  #  ##  ##  #   #  #   #                             #  #  
Q5T0N5         5 TELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRsskdeeprftSCVAFFNILNELNDYAG 84  human
NP_001003634   5 TDLWDQFENLDKHTQWGIDFLERYAKFVKERLEIEQAYAKQLRSLVKKYCPKRskdde-prftSCLSFYAILNELNDYAG 83  zebrafish
XP_422335     20 IFEKDQFDNLDKHTQWGIDFLEKYAKFVKERIEIEQNYAKQLRNLVKKYCPKRsskdeeprftSCIAFFNILNELNDYAG 99  chicken
NP_001090161   5 TELWDQFDNLEKHTQWGIDFLDKYAKFVKERLEIEQNYAKQLRNLVKKYCPKRsakdeeprftSCLSFYNILNELNDYAG 84  African clawed ...
Feature 1                                                                                        
Q5T0N5        85 QREVVAEEMAHRVYGELMRYAHDLKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDtnat 164 human
NP_001003634  84 QREVVAEEMGHKVYGELMRYSQDLKGERKHHLQEGRKAQQYLDQCWKHMDNSKKKFERECKEAEKSQMMYERLDNDinat 163 zebrafish
XP_422335    100 QREVVAEEMGHRVYGELMRYSHDLKTERKMHLQEGRKAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDtnat 179 chicken
NP_001090161  85 QREVVAEEMGHRVYAEIMRYSNDIKGERKSHLHEGRKAQQYLDMCLKQMDNSKRKFERECREAEKAQQTYERLDNDsnat 164 African clawed ...
Feature 1                             #   #                         #   #  #  ##  #   #  #   #   
Q5T0N5       165 KADVEKAKQQLNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPII 244 human
NP_001003634 164 KSEVEKAKSQLYLRQHMAEESKNEYAAQLQNFNGEQWKHFNQAIPQIFTNLQNMDERRTVKLGEMYRSFAEVERRVIPIV 243 zebrafish
XP_422335    180 KADVEKAKQQLNLRTHMADENKNEYAAQLQNFNGEQHKHYYIVIPQIYKQLQEMDERRTIKLSECYKGFADSERKVIPII 259 chicken
NP_001090161 165 RSDVEKAKQQLHLRTHMADESKNEYAAQLQNYNAEQHKHFYIVIPQMYKHLQEMDEHRTVKLSECYKGFADSERKVIPII 244 African clawed ...
Feature 1        #  ##  #    
Q5T0N5       245 SKCLEGMILAAK 256 human
NP_001003634 244 SKCLEGMVTAAK 255 zebrafish
XP_422335    260 SKCLEGMILAAK 271 chicken
NP_001090161 245 SKCLEGMVQAAK 256 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap