Conserved Protein Domain Family
F-BAR_FCHO1

?
cd07674: F-BAR_FCHO1 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 1 protein
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. FCH domain Only 1 (FCHO1) may be involved in clathrin-coated vesicle formation. It contains an N-terminal F-BAR domain and a C-terminal domain of unknown function named SAFF which is also present in FCHO2 and endophilin interacting protein 1. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153358
View PSSM: cd07674
Aligned: 3 rows
Threshold Bit Score: 509.1
Threshold Setting Gi: 51512980
Created: 16-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interfaceputative
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structure of the F-BAR domain dimer of human FCHO2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         #  ###  ##  #  #  ##  ## ##  ##  ##  #  ##  #  #   ##  ###   #  #   #  #        
EAW84630       10 GEKNHGFEVLYHSVKQGPISTKELADFIRERATIEETYSKAMAKLSKLASNGTpmGTFAPLWEVFRVSSDKLALCHLELT 89   human
AAH80369       10 GDKNSGFAVLYHNMKHGQLSVKELADFVRERAAIEESYSKSMQKLSKMVSSGShlGTFAPMWEMFRVSSDKLALCHLELS 89   western clawe...
XP_001921022   71 GEKNAGFDVLYHNMKHGQIATKELAEFVRERAAIEETYSKSMSKLAKMASNGSplGTFAPMWDVFRVSSDKLALCHLELM 150  zebrafish
Feature 1                                                     #   #  ##  #                        
EAW84630       90 RKLQDLIKDVLRYGEEQLKTHKKCKEEVVSTLDAVQVLSGVSQLLPKSRENYLNRCMDQERLRRestsqkEMDKAETKTK 169  human
AAH80369       90 KKLHDLIKDISRYGDEQIKMHKKSKDEMSGTLEAIQLLQCNSQMLQKSRDNYCTKFSEQERLRRegslqkELEKAELKTR 169  western clawe...
XP_001921022  151 RKMNDLIRDINKYSDEQVKIHRKTKEEAIGTLESVQSLQVQNGHLQKTREGYHSKCVELERLRKegvpqkELEKAELKCK 230  zebrafish
Feature 1           #  ##  #  #   #  ##   #      #  ##  ## ##  #   #  ##  #  ##  ## ##  #  ###  ##
EAW84630      170 KAAESLRRSVEKYNSARADFEQKMLDSALRFQAMEETHLRHMKALLGSYAHSVEDTHVQIGQVHEEFKQNIENVSVEMLL 249  human
AAH80369      170 KAADSLRCSVEKYNAVRKEFEQKMLQSAQTFQDTEATHLRHMKRLVTAYSHSVEDTHVQIGQVHEEFKHNMENVAVEKLI 249  western clawe...
XP_001921022  231 KAAESFAGSIEKFNRAGGDFEQKMSESAQKFQDIEEAHLRQMKLLIKGYSHSIEDTHVQVGQVHEEFKQNVENIGIENLI 310  zebrafish
Feature 1         # ### ######### #####
EAW84630      250 RKFAESKGTGREKPGPLDFEA 270  human
AAH80369      250 RRFAESNGTGTDRPEPVEYEG 270  western clawed frog
XP_001921022  311 QKFTEQKGTGKERPGPVGFEE 331  zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap