2V0O,2V0O


Conserved Protein Domain Family
F-BAR_FCHO2

?
cd07673: F-BAR_FCHO2 
Click on image for an interactive view with Cn3D
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 2 protein
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. The specific function of FCH domain Only 2 (FCHO2) is still unknown. It contains an N-terminal F-BAR domain and a C-terminal domain of unknown function named SAFF which is also present in FCHO1 and endophilin interacting protein 1. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153357
View PSSM: cd07673
Aligned: 4 rows
Threshold Bit Score: 490.725
Threshold Setting Gi: 151568102
Created: 16-Jun-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 95 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:2V0O_AB; interface between monomers in human FCHO2 F-BAR dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        ## #####  ###  ##  #  #  ##  ## ##  ##  ##  #  ##  #  #   ##  ###   #  #   #  # 
2V0O_A         7 YFVENFWGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSqlGTFAPVWDVFKTSTEKLA 86  human
2V0O_B         7 YFVENFWGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSqlGTFAPVWDVFKTSTEKLA 86  human
NP_001135543   5 YFLENFWGEKNSGFDVLYHNMKHGQISTKELSEFIRERSTIEEVYSRSMNKLAKSASNYTqlGTFGPVWDVFKTSTEKLA 84  western clawed ...
NP_001018617   5 YFLENFWGNKNSGFYVLYHNMKHGQISSKELSDFIRERATIEEAYSRSMTKLAKTASNFSqlGTFAPVWDVFKQSTEKLA 84  zebrafish
Feature 1                                                           #   #  ##  #                 
2V0O_A        87 NCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQTIQSITQALQKSKENYNAKCVEQERLKKegatqREIE 166 human
2V0O_B        87 NCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQTIQSITQALQKSKENYNAKCVEQERLKKegatqREIE 166 human
NP_001135543  85 GCHLELVKKLQDLIKEVQKYGEEQLKSHKKTKEEVSGTLEAVQNIQSITQALHKAKDLYNAKCLEQEKLKKegaaaKEIE 164 western clawed ...
NP_001018617  85 ACHMELVRKLQELIKEVQKYVDEQAKNHKKTKEEVASTLEAVHNIQSVSQALLKSKENYINKTLEQERMRKegakqGDLD 164 zebrafish
Feature 1                 #  ##  #  #   #  ##   #      #  ##  ## ##  #   #  ##  #  ##  ## ##  #  
2V0O_A       167 KAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEFINNMAN 246 human
2V0O_B       167 KAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEFINNMAN 246 human
NP_001135543 165 KAAIKTKKATESYKICVEKYAAAKLDFEQKMTETAQKFQDIEEAHLMRVKEIIESYSHSVSEVHIQIGQVHEDFINNMAN 244 western clawed ...
NP_001018617 165 KAGLKVKKATESYKSYVEKYATAKTEFEQRMTETAQKFQGIEEEHILRMQEIIHSYSLSVEETHIQIGEVQQEFVNNMEN 244 zebrafish
Feature 1        ###  ### ### ######### ######
2V0O_A       247 TTVESLIQKFAESKGTGKERPGLIEFEEC 275 human
2V0O_B       247 TTVESLIQKFAESKGTGKERPGLIEFEEC 275 human
NP_001135543 245 ITVDSLLQKFAESKGTGKERPGPIEFEEC 273 western clawed frog
NP_001018617 245 TSVESLIEKLAESRGTGKERPGPIEFEEC 273 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap