Conserved Protein Domain Family
F-BAR_PSTPIP2

?
cd07672: F-BAR_PSTPIP2 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Proline-Serine-Threonine Phosphatase-Interacting Protein 2 (PSTPIP2), also known as Macrophage Actin-associated tYrosine Phosphorylated protein (MAYP), is mostly expressed in hematopoietic cells but is also expressed in the brain. It is involved in regulating cell adhesion and motility. Mutations in the gene encoding murine PSTPIP2 can cause autoinflammatory disorders such as chronic multifocal osteomyelitis and macrophage autoinflammatory disease. PSTPIP2 contains an N-terminal F-BAR domain and lacks the PEST motifs and SH3 domain that are found in PSTPIP1. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153356
View PSSM: cd07672
Aligned: 4 rows
Threshold Bit Score: 402.791
Threshold Setting Gi: 223647214
Created: 19-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human FCHO2, human Pacsin1 and human Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #      #  ##  #  ##  ##  #   #  #   #                       #  #        
Q9H939        15 ILSTIGYDNIIQHLNNGRKNCKEFEDFLKERAAIEERYGKDLLNLSRKkpcgqseintlKRALEVFKQQVDNVAQCHIQL 94  human
ACN10365      15 LTSTGGYDCIIQHLNDGKRTCKEIEDFMKARASIEEKYAKELLGLSKKvcghn-emntlKRSLDMFKLQTEHVSLSHLQL 93  Atlantic salmon
NP_001085583  15 ITSIAGYECLIQHMNDGRKNLKEYEDFLKERASIEEKYGKDLVNLTKKkpcgqteintlKRALDVFKQQIDNIGQSHIQL 94  African clawed ...
XP_001233737  15 LTSTVGYDSIIQHLNDGRKNCKEFEDFLKERAVIEEKYGKELINLSKKkpcgqtelntlKRSLDAFKQQIDNVGQGHIQL 94  chicken
Feature 1                                                                                        
Q9H939        95 AQSLREEARKMEEFREKQKLQRKKTELIMDAIHKQKSLQFKKTMDAKKNYEQKCRDKDeaeqAVSRSANLVNPKQQEKLF 174 human
ACN10365      94 AQTMRDEAKKLEDFRERQKEARKKVEQQMDALHKQRAMQFKKTMESKKTYEQKCRDKEeaeqNMNRNASTSNVKQQEKLL 173 Atlantic salmon
NP_001085583  95 AQTLRDEARKMEEYRERQRQERKKIEAIMDTSHKQKLMQYKKTMESKRNYEQRCREKDeaeqAVACYKNMVNTKQQDKVF 174 African clawed ...
XP_001233737  95 AQTLREEAKKMEDFREKQKLHRKKIELIMEAIHKNRNLQYKKTMEAKRLYEQRCRDKDeaeqAVHRNANLVTQKQQEKLF 174 chicken
Feature 1                     #   #                        #   #  #  ##  #   #  #   #   #  ##  # 
Q9H939       175 VKLATSKTAVEDSDKAYMLHIGTLDKVREEWQSEHIKACEAFEAQECERINFFRNALWLHVNQLSQQCVTSDEMYEQVRK 254 human
ACN10365     174 AKTQQAKQNAEEADRLYMHNVSVLGKTREDWQKEHVKACEVFEKQEVERINTLRNMVWTHLNQLSQQCVTSDELHEEVRK 253 Atlantic salmon
NP_001085583 175 AKLAHSKVTAESADKSYQQNIFLLDKIREDWQKDHVSSCEFLENQEWERVNFFRNAVWTHANQLSQQCVTIDVMCEVVRK 254 African clawed ...
XP_001233737 175 LKLAQTKSSLEDSDRNYQQSITSLEKIREEWQKEHIKACEFFETQECERISYFRNALWLHVNQLSQSCVQNDEKYEDIRK 254 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap