Conserved Protein Domain Family
BAR_SNX18

?
cd07670: BAR_SNX18 
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 18
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX18 is localized to peripheral endosomal structures, and acts in a trafficking pathway that is clathrin-independent but relies on AP-1 and PACS1. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153354
View PSSM: cd07670
Aligned: 4 rows
Threshold Bit Score: 427.046
Threshold Setting Gi: 147907046
Created: 12-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interfaceputative
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                           #  ##  ## ##  #  ##  #       ## ##  #  ##  ##  #    #  #     
Q91ZR2       405 PAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQqafSVGLNQAIA 484 house mouse
XP_001231594 392 PGAVLDLQEVESQVDGFKAFTKKMDESALQLNHTANEFARKQVTGFKKEYQKVGHSFKCLSQAFELDQqafSAGLNQAIA 471 chicken
NP_001086819 382 GSPVLDPHDVDGRLDGFKAFTKRMDEGVLLLSQTAGEFARKQASGFKKEYQKVGLAVKGLGQAFEIDQmafSAGFNRAMA 461 African clawed ...
NP_001093476 358 PPAPLDLQDVESRIDGFKVFSKKMDDSVIQVNATLSEFARKQIAGFKKEYQKVGQSFKYLSQAFEMDQqsySIGLNQAIA 437 zebrafish
Feature 1             #                                                                          
Q91ZR2       485 FTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESRRHVEEGKMEVQKADGIQDRCNTIS 564 house mouse
XP_001231594 472 FTAEAYDTIGDLFADQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESKRHVEEGKMELQKAEGIQERCNIIS 551 chicken
NP_001086819 462 FTGEAYEAIGEMFAEQPRQDLDPIMDLLSVYQGHLANFPDIIHMQRGALTKVRESKKQVEEGKLELQKSSEIQDRCNVIS 541 African clawed ...
NP_001093476 438 YTGEAYEVIGDYFVEQPKQDVDPVMDLLALYQGHLTNYPDIIHVQKGALTKVKESQKHVEEGKMESQHADGIRDRCNIIS 517 zebrafish
Feature 1               #  ## ###  #  ## ### ##  ## ##  ## ##  #
Q91ZR2       565 FATLAEIHHFHQIRVRDFKSQMQHFLQQQIIFFQKVTQKLEEALHKY 611 house mouse
XP_001231594 552 FATLAEINHFHKIRVRDFKSQMQHFLQQQILFFQKVTQKLEEALHKY 598 chicken
NP_001086819 542 YATLAEIHHFHKIRVRDFKSQMQHFLQQQIRFFQKVTLKLEEALQQY 588 African clawed frog
NP_001093476 518 FATMAEIQYFHQTRVRDFKSQMQHFLQQQISFFQKVTGKLEEALQKY 564 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap