Conserved Protein Domain Family
BAR_SNX33

?
cd07669: BAR_SNX33 
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 33
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX33 interacts with Wiskott-Aldrich syndrome protein (WASP) and plays a role in the maintenance of cell shape and cell cycle progression. It modulates the shedding and endocytosis of cellular prion protein (PrP(c)) and amyloid precursor protein (APP). BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153353
View PSSM: cd07669
Aligned: 4 rows
Threshold Bit Score: 413.989
Threshold Setting Gi: 148226843
Created: 12-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interfaceputative
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                           #  ##  ## ##  #  ##  #       ## ##  #  ##  ##  #    #  #     
NP_695003    365 PTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSAFQAISHSFQMDPPFcSEALNSAIS 444 human
NP_001116327 342 PNEHQDLQDVEERIDSFKSFAKKMDDSVMQLTNVASELVRKHLGGFRKEFQRLGNGFQSISQSFLLDPPYsSDALSNAIS 421 zebrafish
XP_002195081 355 PTEHQDLQDVEDRVDAFKAFSKKMDDSVLQLTNVASELVRKHVGGFRKEFQKLGNAFQAISHSFHMDPPYsLDALNNAIS 434 zebra finch
NP_001084772 341 PTEHQDLQDVEERVDVFKAFSKKMDESVLQLSSVVSELARKHLGGFRKEFQKLGAAFQGLSHSFQLDPPYsSEPLVGAIS 420 African clawed ...
Feature 1             #                                                                          
NP_695003    445 HTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRmVQDEADGIRRRCRVVG 524 human
NP_001116327 422 HTGRTYENIGEMFADQPKNDLFQMLDKLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGKmDQGEADGIRKRCRTVG 501 zebrafish
XP_002195081 435 HTGKTYETVGEMFAEQPKNDLFLMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRmDQEEADGIRKRCRVVG 514 zebra finch
NP_001084772 421 HTGRTYEAVGEMFAEQPKNDQFRFLDTLSLYQGLLSNFPDIIHLQKGAFAKVKDSQRMSDEGRmEQDEADGVRKRCRVVG 500 African clawed ...
Feature 1               #  ## ###  #  ## ### ##  ## ##  ## ##  #
NP_695003    525 FALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMY 571 human
NP_001116327 502 FALQAEMNHFHQRREVDFKEMMQAYLRQQIAFYQRVGQQLERTLRMY 548 zebrafish
XP_002195081 515 FALQAEMNHFHERRVADFKRMMQSYLRQQIVFYQRVSQQLEKTLRMY 561 zebra finch
NP_001084772 501 FALQAEINHFHQRRLLDFKQAIQHYLKEQIIFYRRVSQELEKTLHLY 547 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap