2RAI,3DYU


Conserved Protein Domain Family
BAR_SNX9

?
cd07668: BAR_SNX9 
Click on image for an interactive view with Cn3D
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 9
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX9, also known as SH3PX1, is a cytosolic protein that interacts with proteins associated with clathrin-coated pits such as Cdc-42-associated tyrosine kinase 2 (ACK2). It binds class I polyproline sequences found in dynamin 1/2 and the WASP/N-WASP actin regulators. SNX9 is localized to plasma membrane endocytic sites and acts primarily in clathrin-mediated endocytosis. Its array of interacting partners suggests that SNX9 functions at the interface between endocytosis and actin cytoskeletal organization. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153352
View PSSM: cd07668
Aligned: 5 rows
Threshold Bit Score: 456.793
Threshold Setting Gi: 55962489
Created: 12-May-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 52 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:2RAI_AB; interface between monomers of human SNX9 dimer; defined at 4A contacts.
    View structure with Cn3D
  • Structure:3DYU_AB; interface between monomers of human SNX9 dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                           #  ##  ## ##  #  ##  #       ## ##  #  ##  ##  # ## #  #     
2RAI_A       183 EAPDLDLVEIEQKCEAVGKFTKAXDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAIT 262 human
3DYU_A       157 EAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAIT 236 human
XP_419693    391 EAPDLDMVEIEQKCDAVGRFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLALVFSTSGYQGESDLNEAIT 470 chicken
NP_001086616 375 EAQDLDMIEVEQKCEAVSRFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLSQVFGTSGYQGETELNSAIT 454 African clawed ...
CAI11756     399 GLPDMDLIEVEQKCEQFSRFTKAMDDGVKDLLTVGNEHWKRCTGPLPKEYQRIGKAFQNLSSVFTTSGYEGEGTLTDAMT 478 zebrafish
Feature 1             #                                                                          
2RAI_A       263 EAGKTYEEIASLVAEQPKKDLHFLXECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNXVKRVSIXS 342 human
3DYU_A       237 EAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMS 316 human
XP_419693    471 EAGKTYEEIASLVADQPKKDLHFLMETNHEYKGFLGCFPDIIGAHKGAIERVKESDKLVATSKITPQDKQNMVKRVSTMA 550 chicken
NP_001086616 455 EAGKTYEAIANLVEEQPKKDLHYLMETNHEYKGFLSCFPDIISAHKGALEKVKESDKLVVAGKITQQDKANMMKRVSVMS 534 African clawed ...
CAI11756     479 AAGKTYEEIAQMVAEQPKKDLHFLMETNNEYKGLLGCFPDTIGVHKAAIEKVKEADKLVTAGKITASDKTTMGKRASTMS 558 zebrafish
Feature 1               #  ## ###  #  ## ### ##  ## ##  ## ##  ####
2RAI_A       343 YALQAEXNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVX 392 human
3DYU_A       317 YALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM 366 human
XP_419693    551 YALQAEMNHFHSNRIYDYNSVIRLYLEQQAQFYETIAQKLRQALSRFPVM 600 chicken
NP_001086616 535 YALQAEMNHFHSNRIYDYNSVIRLYLEQQIQFYETIAEKLKQALGQFPVM 584 African clawed frog
CAI11756     559 YALQAEMNHFHNNRIYDYNRVMQQYLEQQVKFYEMIAEKLRQAHSQFTTM 608 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap