Conserved Protein Domain Family
BAR_SNX30

?
cd07667: BAR_SNX30 
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 30
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. The specific function of SNX30 is still unknown. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153351
View PSSM: cd07667
Aligned: 5 rows
Threshold Bit Score: 501.067
Threshold Setting Gi: 62955569
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                  #  ##  ## ##  #  ##  #
NP_001013012 190 HPVLSFNEHFNIFLTAKDLNayKKQGIALLTRMGESVKHVTGGYKLRTRPLEFAAIGDYLDTFALKLGTIDRIAQRIIKE 269 human
XP_424910    191 HPVLSFNEHFNVFLTAKDLNayKKQGMALLSKMGESVKYVTGGYKLRSRPLEFAAIGEYLDTFSLKLGTIDRIAQRIIKE 270 chicken
BAE27911     190 HPVLSFNEHFNVFLTAKDLNayKKQGIALLSRVGESVKHVTGGYKLRSRPLEFAAISDYLDTFALKLGTIDRIAQRIIKE 269 house mouse
NP_001089520 205 HPVLSFNEHFNVFLTAKDLNshKKQGVTLLSKMGESVRYVTSGYKLRNRPAEFATVTDYLDTFALKLGTIDRIAQRIIKE 284 African clawed ...
NP_001017798 181 HPVLSFNEHFNAFLSAKDLN--KRQGLALLTKMGESVKYVTGGYKLRGRPVEFAAMGEYLDMFTQKLGTIDRIAQRIIKE 258 zebrafish
Feature 1              ## ##  #  ##  ##             #                                            
NP_001013012 270 EIEYLVELREYGPVYSTWSALEGELAEPLEGVSACIGNCSTALEELTDDMTEDFLPVLREYILYSDSMKSVLKKRDQVQA 349 human
XP_424910    271 QLEYLVELREYGPIYSTWGGLEVELSEPLEGVSACIGNCCTALEELSEDMTDDFLPVLREYILYSESMKNVLKKRDQVQA 350 chicken
BAE27911     270 EIEYLVELREYGPVYSTWSALEGELAEPLEGVSACIGNCSTALEELTDDITEEFLPVLREYVLYSDSMKGVLKKRDQVQA 349 house mouse
NP_001089520 285 EVEYLMELREYGPVYSTWSGLEKELNEPLEGVSACVGNCCTALEELTEDMSEDFMPVIREYILYSESMKTVLKKRDQVQA 364 African clawed ...
NP_001017798 259 QTEFLMELREYGPVYSSWSSFEEDLHEPLEGVSGCVSNCSSALEELTEDMSEDFLPVLREYVLYIESMKNVLKKRDQVQA 338 zebrafish
Feature 1                                                 #  ## ###  #  ## ### ##  ## ##  ## ##  
NP_001013012 350 EYEAKLEAVALRKEDrpkVPADVEKCQDRMECFNADLKADMERWQNNKRQDFRQLLMGMADKNIQYYEKCLMAWESIIPL 429 human
XP_424910    351 EYEAKLEAVALKKEDrpkVPTDVEKCQDRVECFNADLKADMERWQNNKRQDFRQLLMGMADKNIQYYEKCLTAWESIIPL 430 chicken
BAE27911     350 EYEAKLEAVALRKEErpkVPADVEKCQDRMECFNADLKADMERWQSNKRHDFRQLLVGLADKNIQYYEKCLMAWESIIPL 429 house mouse
NP_001089520 365 EYEAKSEAAALKREErstVPTDVEKCQDKVECFNADLKADMDRWQNNKRQDFRQLLMGVADKNIQYYEKCLTAWESIIPL 444 African clawed ...
NP_001017798 339 EYETKLEAVVFREDKktpMPTDVEKCQDRVECFNADLKADWDRWQNNKRQDFRQLLTGMADKNIQYYEKCLAAWESLIPL 418 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap