Conserved Protein Domain Family
BAR_SNX7

?
cd07666: BAR_SNX7 
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. The specific function of SNX7 is still unknown. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153350
View PSSM: cd07666
Aligned: 4 rows
Threshold Bit Score: 444.731
Threshold Setting Gi: 50345112
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                      #  ##  ## ##  #  #
Q9UNH6       131 HPTLTFNEdfkIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGV-KNRPEEFMEMNNFIELFSQKINLIDKISQR 209 human
XP_422321    191 HPTLTFNEdfkIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSVRGGvKNRPEMFTEMNDYMETFSHKINVLDKIAHR 270 chicken
NP_001002229 157 HPIFSSTEdfkIFLTAASEELISHKKQGPGFLSRMGETVKAVAASVRGV-RNRPEEFNDMQEYVEAFSQKINSLDKVTQR 235 zebrafish
NP_001084945 181 HPTLTFNEdfkIFLTAQAWELTSHKKQGPGLFSRMGQTIKAVASSVRGI-KNRPDEFTELGEYVDAFSQKINVLDKISQR 259 African clawed ...
Feature 1        #  #      ## ##  #  ##  ##             #                                        
Q9UNH6       210 IYKEEREYFDEMKEYGPIHILWSASEEDLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEMLMGVMKRRD 289 human
XP_422321    271 IYKEEREYFNEMKEYGPIYTLWSASEEDIADSLKGVASCIDKCCKATEKRMAGLSENLLPVIHEYVLYSEILMGVLKRRD 350 chicken
NP_001002229 236 IIREQREYLEELKECGPTYTLWSNSEQELAEPLKNMADCLDRCYKETDEQVKQLNDQLSPALHEYVLCTETLKAVIRRRD 315 zebrafish
NP_001084945 260 IYKEQKGYYEGLKEYGPVHTLWSASEEELVDSLKGMANCIDKCCKVTDTLNLKLSGELIPIIHEYVLYSETLSGVFKKRD 339 African clawed ...
Feature 1                                                      #  ## ###  #  ## ### ##  ## ##  ##
Q9UNH6       290 QIQAELDSKVEVLTYKKADtd-lLPEEIGKLEDKVECANNALKADWERWKQNMQNDIKLAFTDMAEENIHYYEQCLATWE 368 human
XP_422321    351 QIQSELDSKVDALANKKADkd-lFSEEIGKLEDKVECANNALKADWDRWKQNMQYDMRSAFTKVSDNNLRYYEECLATWE 429 chicken
NP_001002229 316 NIQADFEAKTEALATKKADre-aMKDDLEKLEDRLEWANNALKSDWTRWNKVMRTDLRSAFVDTAERNVSYYEKCLAIWE 394 zebrafish
NP_001084945 340 QIQAEYDYKVEASINKKADntdnLKEEIEKLEDKVECANNALKADWERWKQNMQSDLSATFTNMAENRISHYEECLALWE 419 African clawed ...
Feature 1         ##  
Q9UNH6       369 SFLTS 373 human
XP_422321    430 SFLAS 434 chicken
NP_001002229 395 SFLHS 399 zebrafish
NP_001084945 420 SFLSS 424 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap