Conserved Protein Domain Family
BAR_SNX1

?
cd07665: BAR_SNX1 
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 1
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX1 is a component of the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi. The retromer consists of a cargo-recognition subcomplex and a subcomplex formed by a dimer of sorting nexins (SNX1 and/or SNX2), which ensures effcient cargo sorting by facilitating proper membrane localization of the cargo-recognition subcomplex. SNX1 is localized to a microdomain in early endosomes where it regulates cation-independent mannose-6-phosphate receptor retrieval to the trans Golgi network. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153349
View PSSM: cd07665
Aligned: 4 rows
Threshold Bit Score: 457.992
Threshold Setting Gi: 147904653
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                     #  ##  ## ##  #  ##  #      ## ##  #  ##  ##       
NP_001122143 426 KMLNKATDAVSKMTIKMNEQDVWFDEKIQDVENEEQLLRKLHVMVESLVNHRKELSGNTAAFAKSVAMLGSSEDNTALSR 505 zebrafish
NP_445863    286 KMFNKATDAVSKMTIKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTALFAKSLAMLGSSEDNTALSR 365 Norway rat
XP_425052    278 KMFNKATDAVSKMTIKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDNTALSR 357 chicken
NP_001084834 273 KMFNRATDPVNKMTIKMNESDVWFEDKFQEVESEEQHLRKLHQVVETLVNHRKELALNTALFAKSLAMLGSSEDNTALSR 352 African clawed ...
Feature 1                #                                                                       
NP_001122143 506 ALSQLAEVEDRIEQLHRDQAANDFFTFAELLADYIRLLGAVRGCFDQRMKAWQRWQDAESMLQKKREAeakllwankpdk 585 zebrafish
NP_445863    366 ALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRWQDAQATLQKKRESearllwankpdk 445 Norway rat
XP_425052    358 ALSQLAEVEEKIEQLHQEQANNDFFVLAELLGDYIRLLSVVRGAFDQRMKTWQRWQDAQTMLQKKREMearllwankpdk 437 chicken
NP_001084834 353 ALSQLAEVEEKLEQLHQEQANSDFFLLAELLADYIRLLSAVRGVFDQRIKTWQRWQDAQATLQKKRENearllwankpdk 432 African clawed ...
Feature 1                                         #  ## ###  #  ## ### ##  ## ##  ## ##    
NP_001122143 586 lqqakdeiaeWEAKVTQYERDFERISATVQKDVIRFDKEKARDFKRQIIKYLESLLHSQQQLIKYWEAFLPEAK 659 zebrafish
NP_445863    446 lqqakdeiteWESRVTQYERDFERISTVVRKEVTRFEKEKSKDFKNHVIKYLETLLHSQQQLAKYWEAFLPEAR 519 Norway rat
XP_425052    438 lqqakeeiseWESRVTQYERDFERISAVIRKEVIRFEKEKSKDFRNHVTKYLETLLNSQQQLVKYWEAFLPEAK 511 chicken
NP_001084834 433 lqqakdeiaeWESRVTQYERDFERISVTVRKEVMRFEKEKSKDFKSHIVKYLETLLNSQHKLVKYWEAFLPEAK 506 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap