Conserved Protein Domain Family
BAR_SNX2

?
cd07664: BAR_SNX2 
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 2
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX2 is a component of the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi. The retromer consists of a cargo-recognition subcomplex and a subcomplex formed by a dimer of sorting nexins (SNX1 and/or SNX2), which ensures effcient cargo sorting by facilitating proper membrane localization of the cargo-recognition subcomplex. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153348
View PSSM: cd07664
Aligned: 4 rows
Threshold Bit Score: 461.442
Threshold Setting Gi: 33304626
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                     #  ##  ## ##  #  ##  #      ## ##  #  ##  ##       
NP_001012625 282 RMVNKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLKKLHASVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSR 361 chicken
NP_001080484 283 RMVNKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLRKLHGNVESLVCHRKELSANTAAFAKSAAMLGNSEDHTALSR 362 African clawed ...
NP_001032787 270 RMVNKAADAVNKMTIKMNEADAWFEEKQQQFENLDLQLRKLHASVESLVCHRKELSVNTALFAKSAAMLGNSEDHTALSR 349 zebrafish
AAQ02693     283 RMVNKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSR 362 human
Feature 1                #                                                                       
NP_001012625 362 ALSQLAEVEEKIDQLHQEQAFADFYMFSELLGDYIRLIAAVKGVFDHRMKCWQKWQDAQVTLQKKREAeaklqlankpdk 441 chicken
NP_001080484 363 ALSQLAEVEGKIDQLHQDQAFADFYLFSELLSDYIRLIAAVKGVFDQRIKCWQKWQDAQVNLQKKQEAeaklqisnkpdk 442 African clawed ...
NP_001032787 350 ALSQLAEVEEKMDQMHQDQAYADFYLFSELLGDYVRLITAVRGVFDQRMKTWAKWQDAQVMLQRKREAeaklqyankpdk 429 zebrafish
AAQ02693     363 ALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKREAeakmmvankpdk 442 human
Feature 1                                         #  ## ###  #  ## ### ##  ## ##  ## ##    
NP_001012625 442 lqqakdeiKEWESKVQQGEKDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAK 515 chicken
NP_001080484 443 lqqakdeiREWEAKVQQGERDFDQISKTIRKELGRFEKERVRDFKNIIIKYLESLVRTQQQLIKYWEAFLPEAK 516 African clawed frog
NP_001032787 430 lqqakdeiKEWEGKVQQGERDFEQISKNIRREVGRFEKDRVKDFRIVVVKYLESLVHTQQQLIKYWEAFLPEAK 503 zebrafish
AAQ02693     443 iqqakneiREWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAK 516 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap