Conserved Protein Domain Family
BAR_SNX5

?
cd07663: BAR_SNX5 
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 5
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX5, abundantly expressed in macrophages, regulates macropinocytosis, a process that enables cells to internalize large amounts of external solutes. It may also be a component of the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi, acting as a mammalian equivalent of yeast Vsp17p. It also binds the Fanconi anaemia complementation group A protein (FANCA). SNX5 is localized to a subdomain of early endosome and is recruited to the plasma membrane following EGF stimulation and elevation of PI(3,4)P2 levels. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153347
View PSSM: cd07663
Aligned: 4 rows
Threshold Bit Score: 373.117
Threshold Setting Gi: 49899170
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                      #  ##  ## ##  #  ##  #      ## ##  #  ##  ##      
NP_001088935 181 VFFKNMVKSADEMLFSGVKEVDEFFEQEKTFLVNYYNRIKDSCAKADRMTRTQKTVADDYIHISAALTCVAEEESTPVRK 260 African clawed ...
NP_001006178  80 FLLKSVVKSADEILLSGVKEVDDFFEQEKTFLVNYHNRIKDACAKADKMTRSRKNIADDYIYTSACLNSLASEEPTVIKK 159 chicken
AAH62638     193 GFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKK 272 human
AAH75758     180 GFFKNMVKTADEVLISGVKEVDEFFEQEKTFLLDYSNKIKDSTAKAEKMTRSHKNVADDYNHISGALNSVAADNNSAFKK 259 zebrafish
Feature 1                #                                                                       
NP_001088935 261 YLLKLAELFEKLRKVEARVASDQDLKLSELLRYYMLNIEAAKDLLHRRTKSLADYENSNKALDKARLKskdvkqAEQHQQ 340 African clawed ...
NP_001006178 160 YLLKVAELFEKLRKVESRVSSDEDLKLSELLRYYMLNIDAAKDLLYRRARALVGYENSNKALDKARLKskdvnlAEAHQQ 239 chicken
AAH62638     273 YLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKskdvklAEAHQQ 352 human
AAH75758     260 HLEKCVEVFEKLRKVEDRVASDQELKLTELLRYYTRDIQAAKDLLYRRARALADYENSNKALDKARLKgkdvpqAEENQK 339 zebrafish
Feature 1                         #  ## ###  #  ## ### ##  ## ##  ## ##    
NP_001088935 341 ESCQKFEKLSESAKQELVGFKRRRVAAFRKNLVEMTELEIKHAKNNISLLQSCIDLFK 398 African clawed frog
NP_001006178 240 DCYQKFEKISESAKQELISFKQKRITAFRKNLIEMAELEIKHAKNNVSLLQSCIDLFK 297 chicken
AAH62638     353 ECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFK 410 human
AAH75758     340 QCLQKFDRLSESGKKELTSFKARRVVAFRKNLIEMTELEIKHAKNSMSTLQGSIELLK 397 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap