Conserved Protein Domain Family
BAR_SNX6

?
cd07662: BAR_SNX6 
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 6
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX6 forms a stable complex with SNX1 and may be a component of the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi, acting as a mammalian equivalent of yeast Vsp17p. It interacts with the receptor serine/threonine kinases from the transforming growth factor-beta family. It also plays roles in enhancing the degradation of EGFR and in regulating the activity of Na,K-ATPase through its interaction with Translationally Controlled Tumor Protein (TCTP). BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153346
View PSSM: cd07662
Aligned: 4 rows
Threshold Bit Score: 395.178
Threshold Setting Gi: 71834572
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                      #  ##  ## ##  #  ##  #      ## ##  #  ##  ##      
Q9UNH7       186 DFFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDSTDICK 265 human
NP_001025388 186 DFFKNVVKSADGVLVAGVKDVDDFFEHEKTFLLEYHNRVKDSSAKSDRMIRSHKSAADDINRIASTLYTLGTQDSTDLCK 265 zebrafish
NP_001073225 186 DFFKNMVKSADGVIVSGVKDVDDFFEHERTFLVEYHNRVKDASAKSDKMTRSHKNVADDYNRIGSSLYALGTQDSTDICK 265 chicken
NP_001086691 186 DFFKSVVKSADGVIVSGTKDVDDFFDHERTFLVEYHNRVKDSTAKSDKMTRSHKSTADDYNRIGSSMYTLGTQDNSDICK 265 African clawed ...
Feature 1                #                                                                       
Q9UNH7       266 FFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKnkdvlqAETSQQ 345 human
NP_001025388 266 FFLKVSELFEKTRKIEARVAADEDLKLADLLKYYLRESQAAKDLLYRRGRALVDYENANKALDKARAKnkdvlqAETTQQ 345 zebrafish
NP_001073225 266 FFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKnkdvlqAETTQQ 345 chicken
NP_001086691 266 FFLRVSELFDKTRKIESRVAADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKnkdvlaAETTQQ 345 African clawed ...
Feature 1                         #  ## ###  #  ## ### ##  ## ##  ## ##    
Q9UNH7       346 LCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLN 403 human
NP_001025388 346 VCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLGVLK 403 zebrafish
NP_001073225 346 ICCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLAVLN 403 chicken
NP_001086691 346 LSCQKFEKISESAKQELMDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLAVLN 403 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap