Conserved Protein Domain Family
BAR_ICA69

?
cd07661: BAR_ICA69 
The Bin/Amphiphysin/Rvs (BAR) domain of Islet Cell Autoantigen 69-kDa
The BAR domain of Arfaptin-like proteins, also called the Arfaptin domain, is a dimerization and lipid binding module that can detect and drive membrane curvature. Islet cell autoantigen 69-kDa (ICA69) is a diabetes-associated autoantigen that is highly expressed in brain and beta cells. It is involved in membrane trafficking at the Golgi complex in neurosecretory cells. It is coexpressed with Protein Interacting with C Kinase 1 (PICK1), also a the BAR domain containing protein, in many tissues at different developmental stages. In neurons, ICA69 colocalizes with PICK1 in cell bodies and dendrites but is absent in synapses where PICK1 is enriched. ICA69 contains an N-terminal BAR domain and a conserved C-terminal domain of unknown function. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. ICA69 associates with PICK1 through their BAR domains to form a heterodimer which is involved in regulating the synaptic targeting and surface expression of AMPA receptors. Autoantibodies against ICA69 have been identified in patients with insulin-dependent diabetes mellitus, rheumatoid arthritis, and primary Sjogren's syndrome. ICA69 has also been shown to be released by pancreatic cancer cells.
Statistics
?
PSSM-Id: 153345
View PSSM: cd07661
Aligned: 6 rows
Threshold Bit Score: 331.363
Threshold Setting Gi: 17508663
Created: 20-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interfaceputative Rac
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the dimer structure of human Arfaptin 2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                        ##     #   #  #  ##  #  ##   # ##  #  ##    ## ##  #   #        
NP_963881     54 DADLDAKLEFFRSVQSTCTELLKVIEKYQQRITHLSQEENELGLFLRFQAEHDKTKa-gSMMDATSKALCCSAKQRLALC 132 zebrafish
XP_001198366 161 DSELDAKLEVFKSIQNTCMEMLRIIENYQDNLCALSQEEGSMGRFLKQCSSVDKTRa-gKMMAAVGKAQTSSSEQRLALR 239 purple urchin
XP_316657     33 DGELDSKIELFRSVADSCSKLYRIIDQYQERVCILAQEENSLGKFLREVSKESPTTg--KMMSTTGKAISYCGQQRIAIR 110 Anopheles gambi...
Q05084        53 DADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRa-gKMMQATGKALCFSSQQRLALR 131 human
7296389       33 DAELDSKIEVFKSISDTSLNLCKIIDQYQERLCILSQEECVFGRFLKEAGKRSRTTg--GSIAHTAKAVSFAGQQRMCVR 110 fruit fly
NP_491216     46 DNELDTCLNLYRSVHGTSFQLLNNVDNYANFLLDETLVQNVLGKYLKEKGKIDKTEavgRILIAVGRSLLFSSHRLNAAR 125 Caenorhabditis ...
Feature 1                                                                                        
NP_963881    133 TPLHRLEQKVETFRRRAIADSLLTVSRMEKARTEYRAALLWMKASSQEldpdtykQLEKFRMVQAQVRETKVCFDKLKND 212 zebrafish
XP_001198366 240 PPLARLYQEIETFRYRAISDTLMTINRMEGSRLEYRAALLWMKDISKEldpdtykQLEKFRKVQAQVRSTKARFEKLKND 319 purple urchin
XP_316657    111 VPLLRLHHDVHTFKGRAIADTHHTIQQMERERTEYRAALSWMKSVSAQldpdtgrGLEKFRKAQRHVKSAKTKFDKYTLD 190 Anopheles gambi...
Q05084       132 NPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQEldpdlykQMEKFRKVQTQVRLAKKNFDKLKMD 211 human
7296389      111 VPLLRLQHEVDVFRCRAIKDTEQTLQTMEKERTEYRAALSWMKSASQEldpdtgkGLDKFRTAQAHVRVAKHNFDGYSMD 190 fruit fly
NP_491216    126 IGVSTFYNKLSVFVERAIGDCSQTIEAVQMCRTEYRGSLLWMKKTSEEldpevdgSMEKFREAQTTVKSNKERLDRLKTD 205 Caenorhabditis ...
Feature 1                   #   ##  ## ##      ## ##          
NP_963881    213 VCQKVDMLGASRCNMLSHSLCTYQTTLLQYWEKTAHVMSGIHEAF 257 zebrafish
XP_001198366 320 VCQKVDLLGASRCNLFSHTLASYQNTLLHFWEKTSRTMAAVQEGF 364 purple urchin
XP_316657    191 CLEKIDLLAAARCNMFSHALVGYQNAILQFAKKTDETYKNTLKSL 235 Anopheles gambiae str. PEST
Q05084       212 VCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESF 256 human
7296389      191 SIQKIDLLAAARCNMYSHALVAYVTELKNFAQKAASTFQTISKAL 235 fruit fly
NP_491216    206 TLQKVDLLSASRSNLLSYVLTHYQNELYEYYSKTSRAFETLAENI 250 Caenorhabditis elegans

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap