Conserved Protein Domain Family
F-BAR_srGAP

?
cd07656: F-BAR_srGAP 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Proteins
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Slit-Robo GTPase Activating Proteins (srGAPs) are Rho GAPs that interact with Robo1, the transmembrane receptor of Slit proteins. Slit proteins are secreted proteins that control axon guidance and the migration of neurons and leukocytes. Vertebrates contain three isoforms of srGAPs, all of which are expressed during embryonic and early development in the nervous system but with different localization and timing. srGAPs contain an N-terminal F-BAR domain, a Rho GAP domain, and a C-terminal SH3 domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153340
View PSSM: cd07656
Aligned: 16 rows
Threshold Bit Score: 275.363
Threshold Setting Gi: 196004142
Created: 16-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human FCHO2, human Pacsin1 and human Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #  #           #  ##  #  ##  ##  #   #  #   #                              
Q91Z69         26 AQLVEQQKCLEQQ-----TEMRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERfmaktrstkdhqqf----kkdqnllsp 96   house mouse
EEB12153       18 LQLSEQLRCLDVR-----MEAQVALVAELQDYFRKRAELELDYSKNLDKLAKSlqlrhkeqkqkre-------hwplfss 85   human body louse
XP_002204044   52 QQLTDQLKCLDSR-----MEAQAALMADLQDFFRRKAEIELEYSKSLEKLADRfltkvkqqqkldasktgekkdghilsp 126  Florida lancelet
CAG07448       26 CQLVDQLKVFDLQ-----LEQKSQQLQELTDYLRRRSEIESEYARSLDKMADRftsrikrltltslrg--lrkesssntv 98   spotted green...
NP_956738      26 LQLAEQLRIFDGQ-----VEQKTQVFQDMVDYLRRRGEIEGEYARSLDKLCDKfssrtkkkes------------shqsv 88   zebrafish
XP_001638928   11 QLLSEQLKGYDAR-----TEGKVLFLADLQEYCKKMSEVETEYSKNLDRLSDRfldrlqkfkaqr--------cfkrstt 77   starlet sea a...
XP_001899389   16 SQLNDQLRCLETR-----TEAQTAILLELNDYYRKKAELDGEYGKQLEKLAKNimqkhknerykrd-------awtlhst 83   agent of lymp...
NP_502179      60 TKMSDQLKCLGDR-----TDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSiaqkhksersrre-------gwpqhts 127  nematode
XP_799014      24 HHLSEQLKSLDNR-----AENQRELITDYQEYFRQRSEIETQYAKDLEKLHDRtvrkqrqsqsqre------kdvvppgp 92   purple urchin
XP_001663518   76 QQLVNQTKSLSKDhaalsEIYSVHLVARLQSVWDDVQRIYRKVSYPKLNLTDPgtdvlseilagvhk----ilfmlfirr 151  yellow fever ...
Feature 1                      #  #                                                               
Q91Z69         97 vncwyLLLNQVRRESKDHATLSDIYLNNVIm------------RFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTV 164  house mouse
EEB12153       86 yscwqQLVTQTKNLSKDHAALSEIHSTHLVs------------RLGQVMEDVQRIYRKCREIGYETHEDILRVLHELHTT 153  human body louse
XP_002204044  127 yncwyQLLGVTRRESRNHSTLSDIYSTNLTs------------RFTQISEDVGRIFRKSREITTTCHEDLVRVLNELYTA 194  Florida lancelet
CAG07448       99 akvwvALLSQTRQESRDHNRLSENCSSVLIq------------PLTQCLEYTQRLAKKSKDICMQLQDGLLKVTMEMQTA 166  spotted green...
NP_956738      89 vncwqVLLAQTRQESRDHSILSDSYSNILPq------------QLSHCIEHAQRLAKRSREICTLLQDGLLKVTIELHTT 156  zebrafish
XP_001638928   78 mdvwhKLLVETKNRAKQRQSFSDNLANNIAn------------RFMSMSDDYQRISKKCREAGLILQDELCKTVHELQRK 145  starlet sea a...
XP_001899389   84 cglwqQLVDQTKEEAKQKMALADLYAARLTv------------LITQRADDLQRISRKCREIGALAHGEICRVINELHTA 151  agent of lymp...
NP_502179     128 stvwhTLVEQTKEEYKKRQSLGELYGKQMTa------------SIETRCEDLAKISKRCREIGSYSHNELNRVLTELQTA 195  nematode
XP_799014      93 skcwnLILDITKNHHRQHTTLSQVFSYNMAm------------KFGLMRDELDNVYRKSREMTVEVHNEILRVLNELFAE 160  purple urchin
XP_001663518  152 ilkkiRIYRWTKYFSRNLSLINDLNIFFDViemkkskftevitNIYSLEHQNNKSGQVCREIGFETHVEILRILQELHTN 231  yellow fever ...
Feature 1                                                        #   #                        #   
Q91Z69        165 MKTYHMYHSESISAESKLKEAEKQEekqigrsgdpvfhirleeRHQRRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYL 244  house mouse
EEB12153      154 MKTYHAYQAEFRQAENKLKVAENQRlkqes--------tlpreKLDRSKKYRLIEKEVQKRKNKYNDAKLKALKARNEYM 225  human body louse
XP_002204044  195 LKTYHLYHSESAIAEGKLKSVESKMl----------------kTDDKARPSKRVKTMQEKRQAKYFESKQKSIKARNEYL 258  Florida lancelet
CAG07448      167 WRTYYQYHSDYVSADGKLKEAEKQE------------------EKQKQSAAKKLERLIEKRQEKVQETYLKSSKARNEYL 228  spotted green...
NP_956738     157 LKTYYQYYTEFLSAEGKLKEAVKLE------------------EKQKQSASKKMERQIEKRQCKVQEIQLKCTKARNDYL 218  zebrafish
XP_001638928  146 LRKYHTMFGESKTAESKLKSTEIALs----------------kSEESGRKNEKMTKQKEKHQQRYSENKRKSVKAKNEYV 209  starlet sea a...
XP_001899389  152 MRTYQLCFLECSSLESKFRQVEENKakyee---------nnptKLGITRKHRCLAKLYNKRLEKYNAIKLKCLKARNEYL 222  agent of lymp...
NP_502179     196 MKTYQLCYAEMCGIERKKRSAEEDVkryed---------snpgKYEGSRRHRSLVKYFKRREEKFEVVRLKCTKARNEYL 266  nematode
XP_799014     161 TKSYHTAHATYKTSDDKLQQIQSDLe----------------kARKKGRRIKEHERNFDKGNQKLQNAQVKAARARNDYL 224  purple urchin
XP_001663518  232 MKTYHTYQTEAKEAEKKLRAAETQRmklqq--------svpkeKLERSKKYKLIEKEVLKRKNKYTDARLKALKAKNEYQ 303  yellow fever ...
Feature 1         #  #  ##  #   #  #   #   #  ##  # 
Q91Z69        245 LTLEATNASVFKYYIHDLSDLIDCCDLGYHASLN 278  house mouse
EEB12153      226 LCLEASNTTIHKYFVDDLSDLIDCMDFGFHNCIS 259  human body louse
XP_002204044  259 LSLDASNSAIHKYFVNDLSDLVDCMDLGFHSAFG 292  Florida lancelet
CAG07448      229 INLGASNATMKNFYLQDISALIDCADAGYHLVLG 262  spotted green pufferfish
NP_956738     219 LNLAAANACMNKYYLQDLSTLIDCCDLGYHQSIS 252  zebrafish
XP_001638928  210 LALKSTNSFLQYYYTNCLGDLVDGFDFNFHDSFE 243  starlet sea anemone
XP_001899389  223 LCVQAANAALHKYFADDLSDLIDCMDLGMDQWLQ 256  agent of lymphatic filariasis
NP_502179     267 LCVKAANAALHRFFAQDLSYLIDCMDLGMDFWLR 300  nematode
XP_799014     225 LVISAANATIQKYFGPNVTELIDCLDLGYVRKTQ 258  purple urchin
XP_001663518  304 LCLEASNTTIHKYFVEDLSDLIDCMDLGFHSVVS 337  yellow fever mosquito

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap