2EFL,2EFK


Conserved Protein Domain Family
F-BAR_CIP4-like

?
cd07653: F-BAR_CIP4-like 
Click on image for an interactive view with Cn3D
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. This subfamily is composed of Cdc42-Interacting Protein 4 (CIP4), Formin Binding Protein 17 (FBP17), FormiN Binding Protein 1-Like (FNBP1L), and similar proteins. CIP4 and FNBP1L are Cdc42 effectors that bind Wiskott-Aldrich syndrome protein (WASP) and function in endocytosis. CIP4 and FBP17 bind to the Fas ligand and may be implicated in the inflammatory response. CIP4 may also play a role in phagocytosis. Members of this subfamily typically contain an N-terminal F-BAR domain and a C-terminal SH3 domain. In addition, some members such as FNBP1L contain a central Cdc42-binding HR1 domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153337
View PSSM: cd07653
Aligned: 20 rows
Threshold Bit Score: 271.434
Threshold Setting Gi: 167524036
Created: 16-Jun-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 31 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #      #  ##  #  ##  ##  #   #  #   #                              #  # 
2EFL_A        10 TELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKnskeeeeykytSCKAFISNLNEXNDYA 89  human
XP_001639211   5 KELWDQFELVKEHTHNGIEYVDRVYKFVKERSSIEANYARELRKLAKNFQPKKkaeee--lkftFHKGFFDVVKETDDIA 82  starlet sea ane...
XP_001635408   5 VDLWDQFDLVAAHSERGIDLVKRISRFAKERCRIEAEYAKELRKLAKSFHTKKkhede--lqysSHKAFSDVVKETDDKA 82  starlet sea ane...
XP_002128248   5 IELWDQFDSVDKYLQHGFDFGEKYGKFIKERCQIEQEYAGRLRKLVKSYQPKKkdedr--smfsTHKAFQSQLSELNDIA 82  Ciona intestinalis
XP_001897054  10 ADLWDQIDILASHTQKGIESLEKYGMFLKERAAIEDEYAARLRALVKKNLGKKredeeltkaytFISSFHSILHEVESLA 89  agent of lympha...
NP_741723      8 DQLWDQQGTLNEYTGKGIDLLERIMAYSKERASIELEYSSKLKALSKKTAMKMkseselwnsvsYVKGFHDVIAGIVPVA 87  nematode
XP_001196219   5 TDLWDQISNLEKHTDRGIDYVDRFGSFVKERQKIEIEYASQLKKLHKNYLPKKkeeed--ykytALHAFRQILSEVNSIA 82  purple urchin
NP_499838      8 FTVQDPSNALLSYTQKGIDFFEKLGQFSKEKAAIEEEYSTKLRSLAKKYAKKSeeddeilksvsYTSSFNSFLQQLDQIA 87  nematode
XP_001746354   5 TELWDCIAAIEVQTDEGIQFISQVRTFAAKVAEIEKESASKLLALTKQFEPTLnvhp---hspmFAQCWKDLVGMVGDAA 81  Monosiga brevic...
XP_001749153 116 LDLWDQEKTIFERVDHGIEFFNNCRHLIQAQAALEAHYAKELQKLIKQYGDLKqdcgg--eessMMKAWRTVLEQLDAIG 193 Monosiga brevic...
Feature 1                                                                                        
2EFL_A        90 GQHEVISENXASQIIVDLARYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKXDADinv 169 human
XP_001639211  83 GQHELIVENLNSSVLKELQDLHSELKTDRKKHILEGIKVQDALQQSMKMLDGSKKAYEKAKSEAEQALAAFQRADQDmsm 162 starlet sea ane...
XP_001635408  83 GQHELIAENMSAEIYKELHKLHSELEHEKRKHCSDAKKEQDDMDHSMRALDTSKKAYEKAKFEAEQALQAYQKAEQDsni 162 starlet sea ane...
XP_002128248  83 GQHEIVAETMVLNILKSCQTFINDQKLEKKKLYQEGKSMQIALDKVEQNVDHTKKKFEKEWKDCERLQANHEKLDADtnv 162 Ciona intestinalis
XP_001897054  90 GQHEVIAEGLRKDIHPALLTKCAALRAARKNHLNELHIINGVLNASIDNMFKFQKNYCKTFKDAEVAHLKYDKAEKNmdl 169 agent of lympha...
NP_741723     88 TQHELIAENLKSAVIPFTTQKIAEYRVAKKQLESDNSNLGKQLRMVIDEMAKSHKEYVKCYKETEAAMLKYAKAEKNmdi 167 nematode
XP_001196219  83 NQHELIGEYLVTNVLKEVQALISELRSERKKHLQEFKQDDNNLEKSIRKMEGTKSTYKHSHEAWMTSKMNFEKANEDmnq 162 purple urchin
NP_499838     88 TRHQTSAEHIRGGVVSYVASKTCQMRSSRKNAINDLKTINDKLEDQINEMCKSGKCYLKSFKDAENSYQKFYKADKNlei 167 nematode
XP_001746354  82 NARDVASVSIMNEVCQPLRTLIKEKTQERSELLKQVAQLQNDLQKHAATFEKCKKAYDKVEKDAVAAKVAYEKIEMSevd 161 Monosiga brevic...
XP_001749153 194 KQHELRAEDLNTQCADKMKIVVSEHRNTRKTVASELSKASKKLSSARGKYEAVRKDYERRQRDAIAAKNKLEQAEDEskm 273 Monosiga brevic...
Feature 1                              #   #                         #          #  #  ##  #   #  
2EFL_A       170 tKADVEKARQQAQIRHQXAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEXE-------ERRIVRXGESXKTYAEV 242 human
XP_001639211 163 tKLQVEKFKGTSMEKGQAADRARDEYRNQLEKTNSKQTLHYSSEMPAVFSELQTME-------ENRIKRVGELLTEYSDI 235 starlet sea ane...
XP_001635408 163 aKVQIEKLRGSHKEKGQAADRAKEEYQNQLQMTNNKQMLHYNTDMPAIFDEIQKME-------EKRIARVGELLVHYSEV 235 starlet sea ane...
XP_002128248 163 tKADVERAKYAWNAKKDVVEHCKQDYAAALETFNAEQNAHYNTKMPQVFQKYREAD-------EKRIQKLRELMVEYATI 235 Ciona intestinalis
XP_001897054 170 sRADLERAKNNAMQRTQICEDAKQNYAHALQAANQQQHQHYSQLLPQILERLRTVD-------EERISETKSLMLQSIEA 242 agent of lympha...
NP_741723    168 sRLELEKTKNNYQQKCGMLEESKQTYAVMTTKANEEQSAHYDRKLPQLLDNYKKLH-------TNRILDTVEILSKCVEA 240 nematode
XP_001196219 163 tKAQVEKYRATMNGKNSQKCECKDNYILQLDNTNKEQRDFYYTKIPQIFNTELRFQss----aVMALQEASEAYLVGLFE 238 purple urchin
NP_499838    168 sRLELEKARALANARNEACELAKQDYSALVRKTNAEQKRYHVELLPVIFARLKAVDkeciadmRQVLQKIVSFDDSLADS 247 nematode
XP_001746354 162 kKKKIDQARREYAAKAQAREDAERQLCEDLDTFNRERTVIYYSHMPAVFDSLQAMDenraegvVNQINQTVACLRQAAQS 241 Monosiga brevic...
XP_001749153 274 tEAKIMKLKDDMDKAHRECGTAKENHELSVVEFNLAQKQFYQDEQARLFDLYTKALrcs-lpiMTSCIDTMDLELQAVDA 352 Monosiga brevic...
Feature 1        #   #   #  ##  #    
2EFL_A       243 DRQVIPIIGKCLDGIVKAAE 262 human
XP_001639211 236 ECRVMPIVQTCLDNIKKVAA 255 starlet sea anemone
XP_001635408 236 ESKVMPILQKCLDNIKTIGA 255 starlet sea anemone
XP_002128248 236 DKKVKPIIQKCLDGMEQAGN 255 Ciona intestinalis
XP_001897054 243 ETKVMNIIQRCYDDMKKAAQ 262 agent of lymphatic filariasis
NP_741723    241 ESCVNQIIASCHNDMRRDIG 260 nematode
XP_001196219 239 DTNLCAIHAKRVTIMPKDIN 258 purple urchin
NP_499838    248 TEECRKIMQREVGKIDAEGD 267 nematode
XP_001746354 242 ELRAIDGVEGSCRNFDKGSD 261 Monosiga brevicollis MX1
XP_001749153 353 SSDVHLFCANMKSGIEIPGD 372 Monosiga brevicollis MX1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap