Conserved Protein Domain Family
F-BAR_PombeCdc15_like

?
cd07651: F-BAR_PombeCdc15_like 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins.
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. This subfamily is composed of Schizosaccharomyces pombe Cdc15 and Imp2, and similar proteins. These proteins contain an N-terminal F-BAR domain and a C-terminal SH3 domain. S. pombe Cdc15 and Imp2 play both distinct and overlapping roles in the maintenance and strengthening of the contractile ring at the division site, which is required in cell division. Cdc15 is a component of the actomyosin ring and is required in normal cytokinesis. Imp2 colocalizes with the medial ring during septation and is required for normal septation. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153335
View PSSM: cd07651
Aligned: 16 rows
Threshold Bit Score: 324.641
Threshold Setting Gi: 19114234
Created: 19-May-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human FCHO2, human Pacsin1 and human Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #  #      #  ##  #  ##  ##  #   #  #   #                       #  #        
NP_593322      28 GSEDAGMDALMSRTKSSLSVLESIDEFYAKRASIEREYASKLQELAASSADipevgs-tlnnilSMRTETGSMAKAHEEV 106  fission yeast
XP_001889829   41 GPGDDGPTILFTRMRGASKTTDELISFWNERAVIEEEYSHRLAKLAKLSIGsdeige-lrnsldTLRIETERMAQSHLEL 119  Laccaria bico...
XP_756315      61 GQNDAGFDAISARMKASQRTLDELKSLYKERADIEAEYAKRLAKLSRQAIGysetga-lkaafdIVKAELETTSRTHADL 139  Ustilago mayd...
XP_569072      50 GPGDRGFDVIMARLRGAGRTVEELRAFWKERAAIEDEYAKKLNKLSRFSLGkdeigd-ladslqHLLSETAQQASYHSSL 128  Cryptococcus ...
XP_001732373   26 GENDAGYHVMQSFIKNTTRTMEDLRTFYQERAEIERDYAKRLSKLAKTSLGkyetgp-mrhalnTVRIETEAQSKSHSQL 104  Malassezia gl...
CAG88029       20 GRRDSGFKVIQTKIKHALTTLEELLDFYRERIQIEKDYNKKLEKLNGKILLgshetgslkksldKLSLENKHMVKDNSKF 99   Debaryomyces ...
XP_001889856   36 GLGDGGVDVLFARMRGAARTVEELKNFWKERAAIEEDYAKRLTKLSKMVLGrdeige-lrnsmnAVKVETERQSGFHLSL 114  Laccaria bico...
CAX41930       20 NSPEKSFEIVTTRIKDSLNTLNEIINFYQEKINIEKEYTKKLEKLQSKCILgtnetgtlkqsldKLSIENQSMINYNHKF 99   Candida dubli...
XP_001384310   15 GKNDMGFLAIQTRMRDSIQTLQELLDYYQERMNIEKDYSKRLDKLNSKYIVgtretgalkksldKLMVENKHMVQNNEKF 94   Pichia stipit...
EDK39557       12 GDTNNGFSVVRTRIHDGLRTLQELLDYYHDRISVEKEYVKRLERLNSKIPLgshetgslkkaidSLAVENRHMAQYSDKF 91   Pichia guilli...
Feature 1                                                                                         
NP_593322     107 SQQINTELRNKIREYIDQTEQQKVVAANAIEELYQKKTALEIDLSEKKDAYEYSCNKLNSYmrqtkkMTGRELDKYNLKI 186  fission yeast
XP_001889829  120 AHKIRSDHEARTAQFHDTQVEHRRTRQAALEKKFKQKQTQEAYVQKAREKYEADCVRINSYsqqatfMTGKDLERINMKL 199  Laccaria bico...
XP_756315     140 ASMIKKDLECAVTDFANKSWNTRKAAQANIEKLHKHKQTQESYVNKSREKYEQDCIKINGYtaqsslVQGKDLDKVAYKL 219  Ustilago mayd...
XP_569072     129 SNEIRQTVENPSAELGMRMSNLKKGLQAAVEKAHKNKGLQEGHVQKARDRYEQDCLKLNSYtaqsslTQGKELEKLHTKL 208  Cryptococcus ...
XP_001732373  105 ENSIRKEVEGPLIDFMRRVDSLRRDAQTSVTKLYKHKQSQTQYMNRAREKYETNCTKINAYtaqsnmVQGRDLDKVMAKL 184  Malassezia gl...
CAG88029      100 IKSLSQTNYDKLNHFYAIYYKKVSKIESHMQKIINKQNDLFKTLEMNKNKYQEECSQIKSFrllvqtTWGKELEKNEAKL 179  Debaryomyces ...
XP_001889856  115 AQQIRNDLESPAAAFYTRQLQHKKVAQAAIEKDFKTKQTQETYVTKAREKYEADCMRINSYtaqsslVQGKDLEKIHIKL 194  Laccaria bico...
CAX41930      100 IKTIIHTNLEKLQTFQQLYTQRVNKLEHHMGKVLIKRQQALKELEYYKSKYQEECTQLKSLrlslqtTWGRELDKNQQKF 179  Candida dubli...
XP_001384310   95 VKSINHINYDKINDFYRIYTKKVNRIESHMSKLIARKNDAFKSLEITKAKYQHDCSQMKSLrlsmqtTWGKELEKHEAKY 174  Pichia stipit...
EDK39557       92 AKSVAQQSYDRLNNFTSMYTKKVLKIENHMSKLATKRNDAFKQVEASRTKYQEECAQIKSLrll-vqTTWGKELEKNEAK 170  Pichia guilli...
Feature 1                   #   #                        #   #  #  ##  #   #  #   #   #  ##  # 
NP_593322     187 RQAALAVKKMDAEYRETNELLLTVTREWIDRWTEVCDAFQHIEEYRLEFLKTNMWAYANIISTACVKDDESCEKIRL 263  fission yeast
XP_001889829  200 TRARQTVQANEKDLANFTKGLLDLIPEWEGEWKAFCDSCQDLEEERIDIMKDVIWVYANDVSTICVTDDLSCERVRT 276  Laccaria bicolor...
XP_756315     220 DKAQATVSQNDRDYQNFVRALRDTTVKWNAEWKAYLDQCQDQEEERIDFTKSNLWNFANAVSAVCVADDESCERIRV 296  Ustilago maydis 521
XP_569072     209 DRVRQTIGSNENDFRQFVKVLEVTHQKWEQEWKNFCDHVQDLEEDRMAITKDLMWVYANAVSQVCVEDDSSCERIRE 285  Cryptococcus neo...
XP_001732373  185 ERVQSNIDNDDRDYESFVRALQETTQKWNSEYKSFLDICQDVEEERQDFLKTNVWGLANAISSICVTDDEACERVRV 261  Malassezia globo...
CAG88029      180 NKITSSNINTKKHYQIAVTNFTDLNEIFVRDWSIALKDFYQLEVERIQICKVNCFTFCNNIATLCVDNDQSVDLARS 256  Debaryomyces han...
XP_001889856  195 ERAQQTVQTNERDFANFSKALQDTVHKWEQAWKVFCDQCQDLEEERMEFMRDNMWAYANCVSTVCVADDESCEKMRL 271  Laccaria bicolor...
CAX41930      180 NKINSQINSTRKHYHMALVNYKEINEIYKRDWSISLNDFYKLEVERIQVTKINCFNYCNNIATLCVDQDSAVDLARP 256  Candida dublinie...
XP_001384310  175 NKLNSTISASRNNYQLALTNYRELNDFYKKDWAISLQDLYKLEIERIQTCKVNCFNFCNNIATLCVDNDQALDLARS 251  Pichia stipitis ...
EDK39557      171 LRKLTGSNSSQKNYELALVKYRELDEIYVRDWSLALQDIYQLEIERIQTCKINCFGFCNHVATLCVDNDQAVDIARS 247  Pichia guillierm...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap