Conserved Protein Domain Family
F-BAR_GAS7

?
cd07649: F-BAR_GAS7 
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein 7
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Growth Arrest Specific protein 7 (GAS7) is mainly expressed in the brain and is required for neurite outgrowth. It may also play a role in the protection and migration of embryonic stem cells. Treatment-related acute myeloid leukemia (AML) has been reported resulting from mixed-lineage leukemia (MLL)-GAS7 translocations as a complication of primary cancer treatment. GAS7 contains an N-terminal SH3 domain, followed by a WW domain, and a central F-BAR domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153333
View PSSM: cd07649
Aligned: 5 rows
Threshold Bit Score: 362.41
Threshold Setting Gi: 198418028
Created: 19-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of the F-BAR domain dimers of human FCHO2, human Pacsin1 and human Pacsin2

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #  #      #  ##  #  ##  ##  #   #  #   #                      #  #         
O60861       214 NGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNslasqeegslgeawaQVKKSLADEAEVHLKFS 293 human
XP_415577    214 NNTVSGFEILLQKQLKGKQMQKEMAEFVRERIKIEEEYAKNLSKLSQNslaaqeegtlgeawaQLKKSLADEAEVHLKFS 293 chicken
XP_001333507  81 GATVTGFEVLLQKQLKGKQMQKEMAEFIRERIKIEEEYAKNLSKLSMFpmaaqeegtlgeawaQLKKSLADEAEVHLKFS 160 zebrafish
XP_002123389 236 HTVQTGFCILYQKMLKEKQISKEMADLFKQREALETQYSKGLSAIANSvlaaqeegtlgetwkQVKQATLQEAKIHLDFA 315 Ciona intestinalis
NP_001090555 212 NNTVTGFEDLLQKQLKGKQMQKEMAEFIRERIRIEEEYAKNLAKLSQSslasqeegtlgeswaQVKKSLADEAEVHLKFS 291 African clawed ...
Feature 1                                                                                        
O60861       294 AKLHSEVEKPLMNFRENFKKD-MKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSnkteedikKA 372 human
XP_415577    294 SKLQSEVEKPLLNFRENFKKD-MKKCDHHIADLRKQLASRYAAVEKARKALTERQKDLEMKTQQLEVKLSnkteeeikKA 372 chicken
XP_001333507 161 SKLQSEVEKPLLTFRGDNFKKdMKKYDHHIADLRKQLVSRYAAVEKARKALADRQKDLEVKTQQLEIKLSnkseedikKA 240 zebrafish
XP_002123389 316 NKIRLQVEKPLLDHKEGGKKE-FKKLEADVAELRKQVQLKYLAAERAKHMLLERTKDLEGKMNSTKHTKEdv-----qKA 389 Ciona intestinalis
NP_001090555 292 SKLQSEVEKPLLNFRENFKKD-MKKFDHHIADLRKQLASRYAAVEKARKALAERQKDLEVKTQQLEIKLSnkteedikKA 370 African clawed ...
Feature 1               #   #                        #   #  #  ##  #   #  #   #   #  ##  # 
O60861       373 RRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIRQHLCQYTQLRHETDMFNQSTVEPVDQ 446 human
XP_415577    373 RRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIRQHLCQYTQLRHETDMFNQSTVELVDQ 446 chicken
XP_001333507 241 RRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTSMELEKLEVERIEMIQQHLRQYTTLRHETDMFNQSTLEPVDQ 314 zebrafish
XP_002123389 390 RRKSTKHGEELSHSIELYNHARQQWFEEMVTSSVTMETHEAKRINAIKDILTKYTKLLQDTNTKCQKACDVINQ 463 Ciona intestinalis
NP_001090555 371 RRKSTQAGDDLMRCVDLYNQGQSKWFEEMVTTTLELERLEVERVEMIRQHLCQYTQLRHETDMFNQGTVEPVDQ 444 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap