2V0O,2V0O


Conserved Protein Domain Family
F-BAR_FCHO

?
cd07648: F-BAR_FCHO 
Click on image for an interactive view with Cn3D
The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only proteins
F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Proteins in this group have been named FCH domain Only (FCHO) proteins. Vertebrates have two members, FCHO1 and FCHO2. These proteins contain an F-BAR domain and a C-terminal domain of unknown function named SAFF which is also present in endophilin interacting protein 1. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules.
Statistics
?
PSSM-Id: 153332
View PSSM: cd07648
Aligned: 15 rows
Threshold Bit Score: 363.97
Threshold Setting Gi: 156370082
Created: 19-May-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 88 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:2V0O_AB; interface between monomers in human FCHO2 F-BAR dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         #  ###  ##  #  #  ##  ## ##  ##    ##  #  ##  #  #   ##   ###   #  #   #  #     
2V0O_A         14 GEKNSGFDVLYHNMKHGQISTKELADFVRERAT--IEEAYSRSMTKLAKSASNYSq-lGTFAPVWDVFKTSTEKLANCHL 90   human
XP_002130852   30 GEKNNGFDVLYHNMKHGQISVKSLQDLFRESAT--TEDVYAKHLTKLAKQAANSSp-lGSFAPMFEVVKVMSEKLSSCHM 106  Ciona intesti...
EAW84630       10 GEKNHGFEVLYHSVKQGPISTKELADFIRERAT--IEETYSKAMAKLSKLASNGTp-mGTFAPLWEVFRVSSDKLALCHL 86   human
EEC10211        4 EVGDKNNGFDVLYHNMKYGYVAAKELAEFFRERslVEETHSKLLSKLARQASSACt-lGTFGPLWIVLRVTSEKLSSLHA 82   black-legged ...
XP_002243720  151 GEKNNGFDVVYHNMKHGQISVKEMVEYLRESAS--VQELNSKSWNKLAKQAANSSq-qGTFSPVWQIVRLMNEKMATVYT 227  Florida lancelet
XP_001628301    1 GEKNAGFDVLYHNMKYGNNASTKLVEFIRERSA--IEENYCKSLVKLAKSACSASq-lGTFEPLWGVLRVATEKLSNAHH 77   starlet sea a...
XP_001900250   36 GEKHHGYHVLYENLKHEEESVQELAQFIKERAA--YEEEWNKFLNKCIAKTNGLTapgSMFANAWLVTKNTVELLTEIQA 113  agent of lymp...
XP_002115329   16 GEKYAGFDVLYNNMKHCRNANQVFGDFLKEISV--AEDTFAKALMKVAKNYANHNa-lGTFQPVFNYIRKSTENVSNLYQ 92   Trichoplax ad...
CAZ30492       12 GEKHSGFDAMYQNFKLCYRTSSEFAEFLRESYT--AEDNYYKTLVKLSKQAGSYNn-tSSFKPCWSLLKQFIDQISQVHL 88   Schistosoma m...
2V0O_B         14 GEKNSGFDVLYHNMKHGQISTKELADFVRERAT--IEEAYSRSMTKLAKSASNYSq-lGTFAPVWDVFKTSTEKLANCHL 90   human
Feature 1                                                        #   #  ##  #                     
2V0O_A         91 DLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQTIQSITQALQKSKENYNAKCVEQERLKKega-tqrEIEKAA 169  human
XP_002130852  107 DCVHKLHEIIKELAKYLEEQKNKHKQVKDELSGTADALHIIQTTTAAVNKSKEKYHQLCMETERLRRasa-pnkEIEKAE 185  Ciona intesti...
EAW84630       87 ELTRKLQDLIKDVLRYGEEQLKTHKKCKEEVVSTLDAVQVLSGVSQLLPKSRENYLNRCMDQERLRRest-sqkEMDKAE 165  human
EEC10211       83 QMVAQLQDLVKEVQRYCEEQHKRHKQVKEEESPTLEVVTGLQHTTGVLAKAREAYVARCLELDKLRKeas--prDLDKAE 160  black-legged ...
XP_002243720  228 ELVHRLQEVAKELQKYGEEQRNKHKSVKEEVQPTADVVTSFQSTTAAVLKAKENYNTKCLDYERLKRega-spkEVEKAE 306  Florida lancelet
XP_001628301   78 QVVVRLQELVKEIKEYGDKQKERHKAAKDEFTTTAEIVQTIQTMTAALTKAKETYYARCQEFERNKRdgt-stkELEKAE 156  starlet sea a...
XP_001900250  114 SFYITLQHLLKDVFKYHDDLVRSRKKMKEQDVVDAVNLMQTTTTCLQKSKETYAQRVNELERLKKENat---pkDISKAE 190  agent of lymp...
XP_002115329   93 EDARKMQDLIKDIIKCGETLKEKYKLAKDSVANTADDVQTLQILSANIYKARDIYHGRESEVERLRRena-ttkDIDKML 171  Trichoplax ad...
CAZ30492       89 TIAQERQNLSRDVQKYLEEQHKRQKLIKDTEASTQEVVHAFQVTSVQLQKAKEAYHSRYNEYERSMRlesgsnrDQEKLE 168  Schistosoma m...
2V0O_B         91 DLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQTIQSITQALQKSKENYNAKCVEQERLKKega-tqrEIEKAA 169  human
Feature 1               #  ##  #  #   #  ##   #      #  ##  ## ##  #   #  ##  #  ##  ## ##  #  ###
2V0O_A        170 VKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEFINNMANTTV 249  human
XP_002130852  186 NKVKKSAEEYRAIVAKYATVRSDFEQKMTDSAKRFQEIEEAHLRHMKGVLDNYILSFENANVLINQVHQEFRRQVDEKTI 265  Ciona intesti...
EAW84630      166 TKTKKAAESLRRSVEKYNSARADFEQKMLDSALRFQAMEETHLRHMKALLGSYAHSVEDTHVQIGQVHEEFKQNIENVSV 245  human
EEC10211      161 AKARKACEEYRQLVERHGTVRADFERRMASSCERFQVLEEGHLRHMKEFLTGYARVLDSSHALVGQVHAEFRQQCDALDV 240  black-legged ...
XP_002243720  307 AKFTKAKEDYTQLVEKYENTRVDFTKKMTDSSNQFQEIEEIHLSYMFDIIAKYAQCFHHAHFTIMQIEEDFKRQSEDLGI 386  Florida lancelet
XP_001628301  157 AKMKKAAEEYKALVEKREIIRNDFHDKMVDTCRKFQQIEEEHLQIISRHLETYIGSHMAGWEIMEKVHTEFREQVAALAV 236  starlet sea a...
XP_001900250  191 SKLNKSHDEYKGYVDKYGRIRADFEEKMIKATRLFQAHDQSFLLQMKTFMAIFARALDESASATSQVCALYRDSVDNLDI 270  agent of lymp...
XP_002115329  172 SKAKKASDDYKNALDKFPPARKNFITKFTKSCGVFHSHETFHLERMATLVKKFVELQSYFTSVVQKENDRLTKELTSMRT 251  Trichoplax ad...
CAZ30492      169 VKLKKAQDEYKYSVEKYNNLRNQFVSKMHISCAQFEEIEVAHLEQMKEFLHRYASVWSITGDALGKLHNQFDRDLTELTT 248  Schistosoma m...
2V0O_B        170 VKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEFINNMANTTV 249  human
Feature 1           ### ### ######### #####
2V0O_A        250 ESLIQKFAESKGTGKERPGLIEFEE 274  human
XP_002130852  266 ASLIKQYSDTKGTGTEKPGLMVFEE 290  Ciona intestinalis
EAW84630      246 EMLLRKFAESKGTGREKPGPLDFEA 270  human
EEC10211      241 EALLRQFAQARQTGSEKPEPVTFEE 265  black-legged tick
XP_002243720  387 QKLIQNFAESKGTGTEKPAAIEFEE 411  Florida lancelet
XP_001628301  237 EKLLDQFVRSKGTGMNIPEVITFEE 261  starlet sea anemone
XP_001900250  271 DEMLIKFVETKGTGKDRPEFAVFEE 295  agent of lymphatic filariasis
XP_002115329  252 ENLLQIFVDSKGTGNDIPVDIPFES 276  Trichoplax adhaerens
CAZ30492      249 DRLLNILVTERGTGTSEPQGVQFED 273  Schistosoma mansoni
2V0O_B        250 ESLIQKFAESKGTGKERPGLIEFEE 274  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap