1Y2O


Conserved Protein Domain Family
I-BAR_IMD_IRSp53

?
cd07646: I-BAR_IMD_IRSp53 
Click on image for an interactive view with Cn3D
Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Insulin Receptor tyrosine kinase Substrate p53
The IMD domain, also called Inverse-Bin/Amphiphysin/Rvs (I-BAR) domain, is a dimerization and lipid-binding module that bends membranes and induces membrane protrusions. IRSp53 (Insulin Receptor tyrosine kinase Substrate p53) is also known as BAIAP2 (Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2). It is a scaffolding protein that takes part in many signaling pathways including Cdc42-induced filopodia formation, Rac-mediated lamellipodia extension, and spine morphogenesis. IRSp53 exists as multiple splicing variants that differ mainly at the C-termini. One variant (T-form) is expressed exclusively in human breast cancer cells. The gene encoding IRSp53 is a putative susceptibility gene for Gilles de la Tourette syndrome. IRSp53 contains an N-terminal IMD, a CRIB (Cdc42 and Rac interactive binding motif), an SH3 domain, and a WASP homology 2 (WH2) actin-binding motif at the C-terminus. Its IMD domain binds and bundles actin filaments, binds membranes, and interacts with the small GTPase Rac.
Statistics
?
PSSM-Id: 153330
View PSSM: cd07646
Aligned: 5 rows
Threshold Bit Score: 411.631
Threshold Setting Gi: 61680505
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 74 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:1Y2O; interface between monomers of the human IRSp53 IMD domain dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        #   #  #  ##      ##  ##  #  ## ##  ## ##  ## ##  ## ##  ##  #### ##  ##  #     
1Y2O_A         5 RSEEXHRLTENVYKTIXEQFNPSLRNFIAXGKNYEKALAGVTYAAKGYFDALVKXGELASESQGSKELGDVLFQXAEVHR 84  human
NP_001121436   3 RSDEVNRLTENVYKTIMEQFNPCLRNFIAMGKNYEKALASVTFAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHR 82  western clawed ...
XP_420080     28 AATSANTHCPPFFQTIMEQFNPSLRNFISMGKTYEKALASMTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHR 107 chicken
CAF97892       3 RTEEVNKMTENVYKGILDQFNPSLKNFVAMGKHYEKALTGVTVAAKGYFDALVKLGELASDSQGSKELGDTLFQMAEVHR 82  spotted green p...
NP_001035335   3 RTDEVHRISENVYKNIMEQFNPCLRNFIAMGKNYEKALSSVTFAAKGYFDALVRMGELASESQGSKDLGDVLFQMAEVHR 82  zebrafish
Feature 1         #          #   #                                                               
1Y2O_A        85 QIQNQLEEXLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKsqgskn---pqkysdKE 161 human
NP_001121436  83 QIQNQLEEMLKSLHNELLTQLEQKVELDSRYLNAALKKYQVEHKNKGEALEKCQVELKKLRKKsqgskn---pqkysdKE 159 western clawed ...
XP_420080    108 QIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRNKGDSLDKCQAELKKLRKKsqgskn---pqkysdKE 184 chicken
CAF97892      83 QIQVQLEDVLKLFHSELLAQLEQKLELDIKYLTATLKKYQSERRSKSESIERCQSQLKKLRRKsqgsrhpnkygdremQA 162 spotted green p...
NP_001035335  83 QIQVQLEDMLKCFHNELLSELEKKVDLDARYLTAALKKYQIEHKSKGESLEKCQAELKKLRRKsqgskn---pskygeKE 159 zebrafish
Feature 1                      #   #  ##  ## ### ## ### ##  ## ## ###  #  #   #  ## ## ## ##
1Y2O_A       162 LQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKI 236 human
NP_001121436 160 MQYIEAISNKQGELESHISDGYKTALTEERRRYCFLVEKQCAVAKNSATYYSKGKDLLAQKIPSWHQASADPSKI 234 western clawed frog
XP_420080    185 LQYIEAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKSAITYHAKGKEMLTQKLPLWQQSCSDPNKI 259 chicken
CAF97892     163 SQFVELMSRRQGELDALVATGYKSALTEERRRYCFLVDRQCCVTKLLINHHSKVRELLSQKLSSWQHSCSQPTKL 237 spotted green puffer...
NP_001035335 160 LQYVEAISSKQSELDTFIAEGYKTALSEERRRYCFLVDRQCAVAKNSSAYHGKGKDLLTQKIPVWQQACSDPNKL 234 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap