Conserved Protein Domain Family
I-BAR_IMD_BAIAP2L1

?
cd07645: I-BAR_IMD_BAIAP2L1 
Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 1
The IMD domain, also called Inverse-Bin/Amphiphysin/Rvs (I-BAR) domain, is a dimerization and lipid-binding module that bends membranes and induces membrane protrusions. BAIAP2L1 (Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 1) is also known as IRTKS (Insulin Receptor Tyrosine Kinase Substrate). It is widely expressed, serves as a substrate for the insulin receptor, and binds the small GTPase Rac. It plays a role in regulating the actin cytoskeleton and colocalizes with F-actin, cortactin, VASP, and vinculin. BAIAP2L1 expression leads to the formation of short actin bundles, distinct from filopodia-like protrusions induced by the expression of the related protein IRSp53. It contains an N-terminal IMD, an SH3 domain, and a WASP homology 2 (WH2) actin-binding motif at the C-terminus. The IMD domain of BAIAP2L1 binds and bundles actin filaments, and binds the small GTPase Rac.
Statistics
?
PSSM-Id: 153329
View PSSM: cd07645
Aligned: 4 rows
Threshold Bit Score: 437.041
Threshold Setting Gi: 62955633
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                ##       #  ##  #  ##  #  ## ##   # ##  ## ##  ##        #   #      #  #
NP_061330      6 EEVNRLTESTYRNVMEqFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGEIATGSpvstELGHVLIEISSTHKKL 85  human
NP_001089874   6 DAVAKITESTYKNVMDqFNPGLRNLVNLGRNYEKAVTAMVQAGRAYYDGVARMGELASAShvskELGHVLMDISNVHKKL 85  African clawed ...
NP_001017830   6 DEVNKLTESTYKNVMEqFNPGLRNLINLGKSYEKAVSAMVLAGKQYFDAVSKIGENAAVSpvsrELGVVLMEISDVHRKV 85  zebrafish
XP_414749      6 EEVNKLTESTYKNVMEqFNPGLRNLINLGKNYEKAVNAMVVAGRSYYDSLAKIGDISADSpvskELGQVLVEISRTHKKL 85  chicken
Feature 1                                                                                        
NP_061330     86 NESLDENFKKFHKEIIHELEKKIELDVKYMNATLKRYQTEHKNKLESLEKSQAELKKIRRKSQgsrnalKYEHKEIEYVE 165 human
NP_001089874  86 NDNLEENFKKFHREIVAELERKSEQDIKYMNATLKRYQTEHKNKLDSLEKSQTDLKKLRRKSQggrnvtKYEMKETEYVE 165 African clawed ...
NP_001017830  86 NVELEENFRRFHREVIAELERKTDMDVKYMTATFKRYQTEHKMKQDSLERSQSDLKKVRRKSQgrn-asKYESKENECLE 164 zebrafish
XP_414749     86 NDSLEESFKKFHKEIISELEKKTDLDVKYMTATLKRYQTEHRSKLDSLEKSQAELKKIRRKSQgarnvmKYEHKEMEYLE 165 chicken
Feature 1                         #  ## ##  ## ##  ##  #  ##  #   #  #      ## ##  
NP_061330    166 TVTSRQSEIQKFIADGCKEALLEEKRRFCFLVDKHCGFANHIHYYHLQSAELLNSKLPRWQETCVD 231 human
NP_001089874 166 TITSRQSEVNKFIAQGCREALLEEKRRFCFLVDKHCTFSNYINYFHVQAVDLITSKLPKWQETCSD 231 African clawed frog
NP_001017830 165 TLTHRQMDMQKFIADGCQEALLEEKRRFCFLVDKHCSFSHQVSAFHQKARELLSDNLIVWQEKCSD 230 zebrafish
XP_414749    166 TVSSRQTDIQRFIAEGCREALLEEKRRFCFLVDKHCSFTQHMHFYHAQCAEFLNAKLPGWQEICSD 231 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap