Conserved Protein Domain Family
I-BAR_IMD_BAIAP2L2

?
cd07644: I-BAR_IMD_BAIAP2L2 
Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 2
The IMD domain, also called Inverse-Bin/Amphiphysin/Rvs (I-BAR) domain, is a dimerization and lipid-binding module that bends membranes and induces membrane protrusions. This group is composed of uncharacterized proteins known as BAIAP2L2 (Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 2). They contain an N-terminal IMD, an SH3 domain, and a WASP homology 2 (WH2) actin-binding motif at the C-terminus. The related proteins, BAIAP2L1 and IRSp53, function as regulators of membrane dynamics and the actin cytoskeleton. The IMD domain binds and bundles actin filaments, binds membranes and produces membrane protrusions, and interacts with the small GTPase Rac.
Statistics
?
PSSM-Id: 153328
View PSSM: cd07644
Aligned: 4 rows
Threshold Bit Score: 339.976
Threshold Setting Gi: 124248499
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                ##       #  ##  #  ##  #  ## ##   # ##  ## ##  ##        #   #      #  #
NP_079321      6 DQFYRSTMAIYKSIMEqFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERALqsptsqILGEILVQMSDTQRHL 85  human
AAI57281      23 DSIYASTIGTYKKILGqFNPALENLVYLGNNYLRALNALSEVAETYYNAIKKIGEQALqnvtcqGLGQLLIQMAEHCRTA 102 western clawed ...
XP_416266      2 DLSYRSTISIYKSILEqFNPALENLVYLGNNYLRAFHALSKAAEVYFKAVEKIGERALqsstshVLGEILMQMSDTQRLL 81  chicken
NP_001074273   7 DLLHRSTLSVYNNLMDqFNPGLQKLVTLGNSYIKAFQALALTSEAYFSALAKMGEQALstlssrSLGDVLIQISETQRKL 86  zebrafish
Feature 1                                                                                        
NP_079321     86 NSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSELWRmerkrdKNVREMKESVNRLHAQM 165 human
AAI57281     103 SAGLNIVFQTLHGDIVQQMDKNTKLDMQFITDSQNRYEIEYRHRSANLEKCMSEAWKmerqrdRNLREMKENVNMLHNDM 182 western clawed ...
XP_416266     82 SSDLEVVAQTFHVDLLQHMEKNSKMDVQFISESQKQYELEYRRKANNLEKCTTELWRmerardKNVREMKENVMRLRSEM 161 chicken
NP_001074273  87 TAEAEGVFRWFHVEVLQAMDKNVKLDEEYIEGSRRVYELEVRNQAASLERQLRRGAF------RDSLESSEYMQYLRQSQ 160 zebrafish
Feature 1                #  ## ##  ## ##  ##  #  ##  #   #  #      ## ##
NP_079321    166 QAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRARGMLQNRVLLWKEQS 220 human
AAI57281     183 LAFVKESQRAAELEEKRRYRFLAEKHWLLCSSFLQYHSRAQGLLQTRVPPWKEQI 237 western clawed frog
XP_416266    162 QAFLSNSQREAELEEKRRYRFLAEKHQMLYNTLLQFYSRARGMIQTKAPQWKEQL 216 chicken
NP_001074273 161 HEILKEEERRYRFLAEKHCGLTQSLLYLINKTGVSLQQRADGWKEKVSESRSSRP 215 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap