2D1L


Conserved Protein Domain Family
I-BAR_IMD_MIM

?
cd07643: I-BAR_IMD_MIM 
Click on image for an interactive view with Cn3D
Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Missing In Metastasis
The IMD domain, also called Inverse-Bin/Amphiphysin/Rvs (I-BAR) domain, is a dimerization and lipid-binding module that bends membranes and induces membrane protrusions. Members of this subfamily include missing in metastasis (MIM) or metastasis suppressor 1 (MTSS1), metastasis suppressor 1-like (MTSSL) or ABBA (Actin-Bundling protein with BAIAP2 homology), and similar proteins. They contain an N-terminal IMD and a WASP homology 2 (WH2) actin-binding motif at the C-terminus. MIM was originally identified as a missing transcript from metastatic bladder and prostate cancer cells. It is a scaffold protein that functions in a signaling pathway between the PDGF receptor, Src kinases, and actin assembly. It may also function as a cofactor of the Sonic hedgehog (Shh) transcriptional pathway and may participate in tumor development and progression via this pathway. ABBA regulates actin and plasma membrane dynamics to promote the extension of radial glia, which is important in neuronal migration, axon guidance and neurogenesis. The IMD domain of MIM binds and bundles actin filaments, binds membranes, and interacts with the small GTPase Rac.
Statistics
?
PSSM-Id: 153327
View PSSM: cd07643
Aligned: 10 rows
Threshold Bit Score: 413.769
Threshold Setting Gi: 156555077
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative actin
Conserved site includes 60 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:2D1L; interface between monomers of Mus musculus IMD domain of MIM dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    ##  #   #  ## ##  ##  #  ## ##   # ##  ## ##  ##  ##  #  #   #      #
2D1L_A         10 KECSALGGLFQTIISDXKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADXATNTRggTREIGSALTRXCXRH 89   house mouse
NP_001026125    7 KECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRggTREIGSALTRMCMRH 86   chicken
NP_001014500    7 RDSSALGSLFQQIINDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQKIADAATNSRgaSKEIGTALTRVCLRH 86   fruit fly
XP_799879       6 RDCSVLGGLFQSVINDMKSHSPLWDDFSSKAGKLHTQLRATITVLSAFLDAFQRLADAATNTRgaSKELGASLTRLCLRH 85   purple urchin
XP_002128096    5 KECTLLGTLFQAIVTDLKGSSPAWEDFVNKGTKLHNLLKATTVAMSSFLESIQKIADFTTNTKgsTKDIGSALTRICVRQ 84   Ciona intesti...
NP_001116724    7 KECSALGGLFQIIMNDMKASYPAWEDFVTKGAKLQSQLRTTIIVTSSFLDAFQKVADIATGTRgaTKEIGSALTRMCMRH 86   zebrafish
XP_001604214    7 RECSALGCLFQQIIQDMKNGAPLWEDLISKATKLHTCLKAAILAISAYLEAFQKIADAATNARgaTREIGTALTRICLRH 86   jewel wasp
NP_001087385    7 RECSALGGLFQTIVNDMKASYPTWEDFVSKATKLQSHLKTMIIVTGSFLDAFQKIADMAINTRgaTKEIGSALTRMCMRH 86   African clawe...
CAK04191       54 KECGALGGLFQAIVNDMKYSYPVWEDFITKATKLHSQLRTTVLATAAFLDAFQKVADMATNTRgaTRDIGSALTRMCMRH 133  zebrafish
NP_941027       6 KECGALGGLFQAIVNDMKSSYPIWEDFNSKAAKLHSQLRTTVLAAVAFLDAFQKVADMATNTRgaTRDIGSALTRMCMRH 85   house mouse
Feature 1           #                                                                             
2D1L_A         90 RSIEAKLRQFSSALIDCLINPLQEQXEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKvdaqgrgdIQPQL 169  house mouse
NP_001026125   87 RSIESKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKgr----gdIQPQL 162  chicken
NP_001014500   87 KAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKARKgqt---dgLQSLM 163  fruit fly
XP_799879      86 KSIELKLKSFTSSITEYLVVPLQEKTEEWKKNTVQLDKDHAKEYKKARQDIKKKSSDTIRLQKKARKgk----phVQYQL 161  purple urchin
XP_002128096   85 KMMENKLKLFTNALLDNLVVPIQERLEEWKKVANQLEKDHAKDYKKAMHDIKKRNGETIRLQKKVRKgsk---pdLHQQL 161  Ciona intesti...
NP_001116724   87 RSIENKLKLFTTALMDNLITPLELKIEEWKKVASQLDKDHAKEYKKARSEIKKKSSDTIKLQKKVKKgk----deVRMQL 162  zebrafish
XP_001604214   87 KAVETRLMIFSSAIMDCLVLPLQEKLEDWKKSLVYLDKEHAKEYKKARTELKKKSSDTLRLQKKKARkglqtqqiYGRLL 166  jewel wasp
NP_001087385   87 RNIESRLKHLTVALTDNLINPLEGKMEEWKKVANQLDKDHAKEYKKARADIKKKSSDTIKLQKKVKKgk----ddARLQL 162  African clawe...
CAK04191      134 RSIEAKLRHFTNALMEKMIGPLQDKIEEWKKTAALLDKDHAKEYKRSRQEIKKKSSDTIKLQKKARKgr----ggLQPQL 209  zebrafish
NP_941027      86 RSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARKgk----gdLQPQL 161  house mouse
Feature 1                               #  ## ##  ## ##  ##  #  ##  #  #  ##     ## #########
2D1L_A        170 DSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISXLRPVIEEEISXLGEITHLQTISEDLKSLTXDPHKLP 244  house mouse
NP_001026125  163 DSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISDDLKSLTMDPHKLP 237  chicken
NP_001014500  164 DSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSIALVTKEPSVLP 238  fruit fly
XP_799879     162 DSAMQGVNDMFVLLEEAERNACRNALIEERSRFCTLVGFLGPVVEDEISMLSEVTHLQTVMEDLSAQSKDPHILP 236  purple urchin
XP_002128096  162 NSAMHEVNDRFTSLEETEKSALRNLLVEERTRICLFANCLSPVLDMEVSMLNEVSNLHELTSDVARLCRNPKQLP 236  Ciona intestinalis
NP_001116724  163 DSALQDVNTRYAVLEETEKRAVCRALIEERGRFCSFVTMLKPVLDEEISMLGEVTHLQTILEDLGNLTADPNTLP 237  zebrafish
XP_001604214  167 ESSAAVVQEKRQTLEETERKAVRAALLEERGRFCQFARFLKPVLDEEIAMLMELTHLEEVANQLQKHAASPQQLP 241  jewel wasp
NP_001087385  163 DSALQDVNDKYVVLEETEKKAVYKALVEERGRFCMFVSFLKPVLDEEIGMLGEITHLQTILEDLSSLTAEPSKLP 237  African clawed frog
CAK04191      210 NSAMQDVNDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVVGEIAMLGEATHLQAIIEDLTVLTTDPHKLP 284  zebrafish
NP_941027     162 DSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTADPHKLP 236  house mouse

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap