Conserved Protein Domain Family
BAR_ASAP2

?
cd07642: BAR_ASAP2 
The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 2
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. ASAP2 (ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 2) is also known as DDEF2 (Development and Differentiation Enhancing Factor 2), AMAP2, centaurin beta-3, or PAG3. ASAP2 mediates the functions of Arf GTPases vial dual mechanisms: it exhibits GTPase activating protein (GAP) activity towards class I (Arf1) and II (Arf5) Arfs; and binds class III Arfs (GTP-Arf6) stably without GAP activity. It binds paxillin and is implicated in Fcgamma receptor-mediated phagocytosis in macrophages and in cell migration. ASAP2 contains an N-terminal BAR domain, followed by a Pleckstrin homology (PH) domain, an Arf GAP domain, ankyrin (ANK) repeats, and a C-terminal SH3 domain. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. The BAR domain of the related protein ASAP1 mediates membrane bending, is essential for function, and autoinhibits GAP activity by interacting with the PH and/or Arf GAP domains.
Statistics
?
PSSM-Id: 153326
View PSSM: cd07642
Aligned: 3 rows
Threshold Bit Score: 419.823
Threshold Setting Gi: 206597522
Created: 10-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  #  ##   # ##  ## ##         ## ##  ## ##  #               #  ##        
NP_001128663   34 RNTVAAIEEALDVDRMVLYKMKKSVKAINSSGlahvENEEQYTQALEKFGGNcvcrddpdlgsaflKFSVFTKELTALFK 113  human
NP_001084911   34 RNTVVAIDEALEVDHTILNKMKKSVKAIHTSGlthvENEEQYTQALEKFGSNcvcrddpdlgtaflKFSVFTKELTALFK 113  African clawe...
NP_001038672   34 RNTVSALEEALDVDRSVLYKMKKSVKAIYASGlahvENEEQYTQALEKFGENcvyrddpdlgsaflKFSVFTKELTALFK 113  zebrafish
Feature 1                                                                                         
NP_001128663  114 NLIQNMNNIISFPLDSLLkgdLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHgmirteisgaeiAEEMEKERRF 193  human
NP_001084911  114 NLVQNMNNIITFPLDSLLkgdLKGVKGELKKPFEKAWKDYETKVTKIEKEKKEHAKMHgmirteisgaeiAEEMEKERRV 193  African clawe...
NP_001038672  114 NLFQNMNNIITFPLDSLLkgdLKGVKGDLKKPFDKAWKDYETKVSKIEKEKKEHARQHgmirteisgaeiAEEMEKERRF 193  zebrafish
Feature 1                     #  ## # #  ## ##     ##  ## ##  ## ##      
NP_001128663  194 FQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVESLKPSIETL 248  human
NP_001084911  194 FQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVETLKPSIEKL 248  African clawed frog
NP_001038672  194 FQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVDNLKPSIEKL 248  zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap