Conserved Protein Domain Family
BAR_ASAP3

?
cd07640: BAR_ASAP3 
The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 3
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. ASAP3 (ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 3) is also known as ACAP4 (ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 4), DDEFL1 (Development and Differentiation Enhancing Factor-Like 1), or centaurin beta-6. It is an Arf6-specific GTPase activating protein (GAP) and is co-localized with Arf6 in ruffling membranes upon EGF stimulation. ASAP3 is implicated in the pathogenesis of hepatocellular carcinoma and plays a role in regulating cell migration and invasion. ASAP3 contains an N-terminal BAR domain, followed by a Pleckstrin homology (PH) domain, an Arf GAP domain, ankyrin (ANK) repeats, and a C-terminal SH3 domain. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. The BAR domain of the related protein ASAP1 mediates membrane bending, is essential for function, and autoinhibits GAP activity by interacting with the PH and/or Arf GAP domains.
Statistics
?
PSSM-Id: 153324
View PSSM: cd07640
Aligned: 3 rows
Threshold Bit Score: 377.031
Threshold Setting Gi: 50417145
Created: 10-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 #  ##   # ##  ## ##         ## ##  ## ##  #               #  ##        
NP_001137250  35 RGAALAREEILEGDQAILQRIKKAVRAIHSSGlghvENEEQYREAVESLGNShlsqnshelstgflNLAVFTREVAALFK 114  human
XP_002191384   5 ASSAGGKVMSLDGDQAVLQRIRKYVKAIHISGlthvENEEQYSEALENFGNNhlsqnnhelstgflNLAVFTREVTALFK 84   zebra finch
AAH77145      34 RSTVAALEESLEQDQMSLQKMKKIVKAIHNSGlnhvENKEQYTEVLENLGNShlsqdnnevstgflNLAVFTREVTALFK 113  zebrafish
Feature 1                                                                                        
NP_001137250 115 NLIQNLNNIVSFPLDSLMkgqLRDGRQASLSLGSRAKLEKERDRARVTGGIPGEv--------------AQDMQRERRIF 180  human
XP_002191384  85 NLVQNLNNIVSFPLDSLLkgqLKDGRLDSKKQIEKAWKDYETKVGKMEKEKERArlagviqaepaaaemAEDMQKERRLL 164  zebra finch
AAH77145     114 NLVQNLNNIISFPLENVLkseLRDSRLELKKQMEKSWKDYDAKIGKLEKERREKqkqhgli-rldmtdtAEDMERERRNF 192  zebrafish
Feature 1                   #  ## # #  ## ##     ##  ## ##  ## ##      
NP_001137250 181 QLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFIEKL 234  human
XP_002191384 165 QLHMCEYLLKARESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQNLYPFIEKL 218  zebra finch
AAH77145     193 QLQMCEYLLKIQELKIRQGPDLLQGLIKYFQAQLNFFQDGLKAAENLGPFVEKL 246  zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap