Conserved Protein Domain Family
BAR_SNX_like

?
cd07630: BAR_SNX_like 
The Bin/Amphiphysin/Rvs (BAR) domain of uncharacterized Sorting Nexins
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. This subfamily is composed of uncharacterized proteins with similarity to sorting nexins (SNXs), which are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153314
View PSSM: cd07630
Aligned: 6 rows
Threshold Bit Score: 295.185
Threshold Setting Gi: 198430043
Created: 5-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #  ##  ## ##  #  ##  #      ## ##  #  ##  ##                    #    
ACO11353     235 DLDEAFQKERDMLAKYSANMKKTRDTYHELINCRLRLTNQLSNLASINRLSIGGENrsvgvngelnRLNSKLSTYHTEEA 314 Caligus rogercr...
XP_001625579 222 DINDEFQKLRDFVEKFSLANKECCMNFTKMVNAQQRVGLSLGELSASVSTAAVLDEvssq---nlkRTFTLFSEALTSSK 298 starlet sea ane...
XP_685760    168 DVDNFFQNERNKNTNLAASSKVATEKLLDVVMTEQKLALACGHFSTSLHLCVNQDDaaav---afsKVCLKLSDIIEAIK 244 zebrafish
CAG06729     166 DVDEFFQTEREHNHLLTGCCKTAAEKFLDVVQTEQKIAVACGHFAAALQLCVEPGEdpdk--qaftHACVKLSQVFECMK 243 spotted green p...
XP_002213546 289 DVNEFFQKERDTVNEVSVQMKEAKENFMKIVYGEQRVAVGLSHLSTALHLGGQLQEgadv---vvnKLFTQFSEGLEDAK 365 Florida lancelet
XP_002121301 167 DSDESFQQTRVSNTENIKNMKQAAHAFQKIVDTQYRITNAYAEIYSVLQQMSTDCAapv----fstTLLTPLNEAVQHAI 242 Ciona intestinalis
Feature 1                                                                                        
ACO11353     315 TQIESLVGSEDNTLGVYLDLYSNYSDSVNDMLLKRTSLMTEFDNASKALAKAKlskigsAKVAKDTLEARYNECSKLAAV 394 Caligus rogercr...
XP_001625579 299 ESYEVMSANDENTLGFTIDLYSKYMDSAKDMLFRRTCKLVEFENASKALEKAKpqkkdqCEQAKKEAEDAYTEITDLAST 378 starlet sea ane...
XP_685760    245 RNFEKVASNNLSTLGLGLDLESRYQEAEKEMLFRRTCKLIELETVKKSTEKAKphkrevMEAFQKAVEKEFSLISSVAKE 324 zebrafish
CAG06729     244 RNMASVAENNASTLGLSLDLDYRYQEAEKEMLFRRTCKLVEVETARKNVEKAKpikktaMEEVLKAAQTDFEQISSVAKK 323 spotted green p...
XP_002213546 366 QGLEVMAVNDENTLGFSLDLYSRYLEAEKEMLYRRTCKMMEFEAASKAVEKAKpqkremAVAARDKAEKEFEDISKAAEK 445 Florida lancelet
XP_002121301 243 ELHNVNATNSQRTLGSTLHLYAGYSQSQHDMLQKRVHKAIELDNSKKIYEKAKppkkvqAEEAMKKLATELEVMTSLAKP 322 Ciona intestinalis
Feature 1          #  ## ###  #  ## ### ##  ## ##  ## ##  
ACO11353     395 ELKRFHQRRIVEMKEAILCYTEGQFKAAKEASGGLARTIED 435 Caligus rogercresseyi
XP_001625579 379 EMSRFNRQRVLSLQSAMVQYAESRIKNGRDTYAVLLKLLNY 419 starlet sea anemone
XP_685760    325 EIERFHASRVNVLKSFMVCWCEQQLDTAKECAQLYSQHLEA 365 zebrafish
CAG06729     324 EITRLQGARVEMLQQALVQLCEKQLLTAKENADQFNRQLQA 364 spotted green pufferfish
XP_002213546 446 ELKNFHHQRVLTFQDSLVRHADAKVKAARDTYALLTKCVTA 486 Florida lancelet
XP_002121301 323 ELERYNRQRVLAMQTGLTLLADSEIKNSRDAVAVFTKSCSR 363 Ciona intestinalis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap