Conserved Protein Domain Family
BAR_Atg20p

?
cd07629: BAR_Atg20p 
The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Atg20p
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. The function of Atg20p is unknown but it has been shown to interact with Atg11p, which plays a role in linking cargo molecules with vesicle-forming components. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153313
View PSSM: cd07629
Aligned: 8 rows
Threshold Bit Score: 233.824
Threshold Setting Gi: 189207366
Created: 5-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #  ##   ## ##  #  ##  #      ## ##  #  ##  ##                 #      
A6ZXL6       359 ERSKSFTNIEQDYKQYENlLDNGIYKYNRRTTKTYHDLKSDYNEIGEVFAQFAHEQaqvg-elaEQLSYLSNAFSGSSIS 437 Saccharomyces c...
XP_001645696 388 ERKDGFDIIEQEHKQYESlLKSGFYKHNTQITKSLYGMQHDMKDLSDTFAHFASAQacea-elaEQLTYMSNAYDDAASN 466 Vanderwaltozyma...
XP_001940017 290 ELDPYFVSFENSSKDLEHlLQGPMEKVNRRLLMHLGNWGEDMADLGARFNAFSLSEqtq--tlaAAIEKTGQAVDSTYIA 367 Pyrenophora tri...
XP_502542    289 KQEAFFAEAEKTAKEYEAvIGGGLEKVARRILKRYTDIAGDYAELGGRFNALSLEEsds--rmaATVEKVGQAIDSNYLA 366 Yarrowia lipoly...
XP_569690    261 QPDQRFMDSEAFTEKFQShFSGTMEKVNRRVTKRWGERAHDMSELGGIWNGFSLVEqgk---lgDAIEKVGRAVDAEYLA 337 Cryptococcus ne...
XP_001883764 253 QPDQRFLDSEAFTHKFANhVSGPMEKVTRRVIKRWSDYASDHSDLGASLNGFSLNEpgs---lsAAVEKTGQAVDATFMS 329 Laccaria bicolo...
NP_983803    299 AEDMEFSRIEYEYKKYEQlLHTGVYKYNRRITRTMHELKQDLADLSEAFAEFAVEQskgg-dlaELLSYLSNANDEAAAV 377 Ashbya gossypii...
XP_454363    359 SDADEFTKIEAEFKNYEQlIHSGLYKYSRATTKEVNYLREDLKGISSEFAQLSTDEtknesglaELLSHSSDAYGTLQEI 438 Kluyveromyces l...
Feature 1                                                                                        
A6ZXL6       438 LEKLVGRLYYNINEPLNESVHMATSARELIKYRKLKYLQNEMIKKSLnskraqlekleaqnneykdvdkiidnemsksht 517 Saccharomyces c...
XP_001645696 467 LEALVGLLYYNINEPLGESVRMAGSAKELIKYRKLKGVQLEILINSLeskrqqlhklelqrgvqprngntasgasgndes 546 Vanderwaltozyma...
XP_001940017 368 TTELSSSLSASFSEPMRESAQFAGVVRSVLRYRVLKRIQEDMTKDELekkrnlleslerseaeskrleqhlsgvsqmppp 447 Pyrenophora tri...
XP_502542    367 TNHLVRELGRQFGEPLAESAQFSGVVRSVLKYRKQKALQLELTSDSLeakrvtlaslesaeadsqrindalgrtrsnngp 446 Yarrowia lipoly...
XP_569690    338 TAALLQSWEKTTTEPLHIYSQFATLIRARLSFRHQKHVQYELVQEALetqrdkleilenaerearrleealerggsvlas 417 Cryptococcus ne...
XP_001883764 330 TTKLIQELEQNWAEPLHEYAQFAAIIKRLLAYRHQKHVQYEMTQDVLenkreqleelekserearrleealgrgkvtngl 409 Laccaria bicolo...
NP_983803    378 LDDLVGKIYYNINEPLSEAVHIAGAARELIQYRRLKFAQRDMLKKSLlgkeghlkrlqeqeddakaidqlvdqhlgegtr 457 Ashbya gossypii...
XP_454363    439 LETLVGNLHYNINEPLSECAHMATAVRDLIHYRRLKLIQKDILERTIlykrgqlikfqqqendhkqidnmvkeelgtnga 518 Kluyveromyces l...
Feature 1                                                                                        
A6ZXL6       518 inlerpnnntgs----------------------ggksyggklfngfnklasmvkdsvkyqetdphtasinlkkeieqlS 575 Saccharomyces c...
XP_001645696 547 svkkpqasksq------------------------sssyggkflnrfnkiaamvketinyqeqdpqttmanlikeieqlN 602 Vanderwaltozyma...
XP_001940017 448 rnrsasnssqrsstesdgrqde--drasidsdfppthgetpssaqafgsithafrgmadvdpektrrdqigktrdsmvqL 525 Pyrenophora tri...
XP_502542    447 sttnsgeqpsasp---------------------apkkssgfkipglsslnsafnnmmdadpeasrrqgigktreqigqL 505 Yarrowia lipoly...
XP_569690    418 pqlepeaarderer-------------------aqrrarasqgfgllsavkhslsgmidmdpeatrraniaktrdnisqL 478 Cryptococcus ne...
XP_001883764 410 aspttqdsegnsdtpetpitpgsaflpphpgpnparrrtkapgmgllnalsytlhgmmdvdpevarrngitktrenisqL 489 Laccaria bicolo...
NP_983803    458 inlqrpseasp-------------------------ntykrklfsrfnklanivketvtyqeqdpkvniktvqedieqiK 512 Ashbya gossypii...
XP_454363    519 vnlenpagpq---------------------------sysgkfinkftqlaiiikdsvsyqeqdpaaaarslekeliqlD 571 Kluyveromyces l...
Feature 1                              #  ## ###  #  ## ### ##  ## ##  ## ##  
A6ZXL6       576 ESLEVTENDLEVISKVIKNDQLPKFSKEREVDLSEILKHYSRYMRNYARQNLEIWKEVKRH 636 Saccharomyces cerevisiae YJM789
XP_001645696 603 ESEQVARHDLEDISKIIKEDRLTKFSEEREKELNEILRNYSKYLKDYAKKNLELWKEIKTR 663 Vanderwaltozyma polyspora DSM 70294
XP_001940017 526 EQALTVAEKDTKDASSGVLKDLRRFQNEKEDDLRRYMMEFAQCHIDWAKRNKAAWEEAKTE 586 Pyrenophora tritici-repentis Pt-1C...
XP_502542    506 EQALEVAQKDIVVANESVEKDLERFRAEREADLKCMIRAFLKCHIDWAKQNLDTWQSAQAE 566 Yarrowia lipolytica CLIB122
XP_569690    479 EDSYQAAAQDLKYASMTLQADLDRFQRQKVADLREMAINLSQVHRDWCKQNLEAWKAAQAA 539 Cryptococcus neoformans var. neofo...
XP_001883764 490 EDALHLAAQDLKYSSSTIQADLDRFQRQKVADMREMCISMARSHRDWCKKNLKAWEDAKKE 550 Laccaria bicolor S238N-H82
NP_983803    513 ESLDVSASDLDVITATIRDVQLPAFSRNRDKELYDILKNYSKYMKEYAAKNLEIWKDLRKQ 573 Ashbya gossypii ATCC 10895
XP_454363    572 ETLKVATSDLVVISETLKNTELPNFIKERDEELTQIFKNYAKYMKENATRNLEIWKELHNR 632 Kluyveromyces lactis NRRL Y-1140

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap