Conserved Protein Domain Family

cd07628: BAR_Atg24p 
The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Atg24p
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. Atg24p is involved in membrane fusion events at the vacuolar surface during pexophagy. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
PSSM-Id: 153312
Aligned: 14 rows
Threshold Bit Score: 207.12
Threshold Setting Gi: 129561953
Created: 5-Jun-2009
Updated: 2-Oct-2020
Aligned Rows:
dimer interface
Feature 1:dimer interface [polypeptide binding site]

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                #  ##  ## ##  #  ##  #                       ## ##  #  ##  ##        
AAZ14926  254 KPDERFLAMREDVDKFEEGVTTSERLYNRIRNRSSDGNPesge---------dltaDYHDLAVAVQGLGFLEsg------ 318 Coprinellus dissem...
ABO31320  232 KPDRRFIEVREKADKLDEDLSHVEKTVARVARRESDLET-----------------DYAELATQFRKLVPLEpa------ 288 Penicillium chryso...
EDV12728  186 KQNEEFTEIREKSDKLDRTVTKIDKLFHKVVKKNDSMSE-----------------DYTKLGSNLQELQELVtgen---- 244 Saccharomyces cere...
XP_760067 281 KPDERFEEIRERIDKLEEGLAGTERVLSRNRNRIAALPFgdvyapqlgtgledlstDYEDFATSIEGLGYLEsg------ 354 Ustilago maydis 521
XP_503920 202 QTAQEFQEVKERIDRLDVCVSHIEKVLARSVRRQSDLVM-----------------DYQDLSQHVGQLEHLIps------ 258 Yarrowia lipolytic...
XP_569888 245 KPDARFVEMTEELERFEEGLTGVERVVGRGKSRVDDLAA-----------------DYQDMAAAYQGLGYLEsg------ 301 Cryptococcus neofo...
XP_452689 161 RQRDEFVEIKEKSEKLDHNLSHLDKLFHKSVKRVDLIGQ-----------------NLKKLQSSLSGLQELCcdek---- 219 Kluyveromyces lact...
EDK40859  254 ETNKEIIEISDKLKKLYENLLKLDRLFAKLNKRHSELAT-----------------DYGQYATQVSRLGSTDqsd----- 311 Pichia guilliermon...
Feature 1                   #                                                                 
Feature 1                                                                                    #
Q5H7C3    391 gnnvsgsdgamnfiskkig-------slrgktpgqtyssgnetndrinklnekiefLEREVKETFELFHTFEKNLITEYQ 463 Pichia pastoris
AAZ14926  396 iisghagssglglgayl----------kdrvdalrgldddrsrvekmkkldtkikeLQDAVTTAHETSDAFNDATLREQS 465 Coprinellus dissem...
ABO31320  366 npaayyasnpltsspasf--------irskmedmrgvdheqsrrervrklelrideLTREVESAKTTSEMFDEEVIREVA 437 Penicillium chryso...
EDV12728  324 gyggsnffankle-------------------elaginqeasrrekinklegkitsLTGELENAKKVADGFEQECLKEID 384 Saccharomyces cere...
XP_389333 349 ghgggsgagsflrak---------------iedvrgvdheqarrertrklelrveeLTHEVESARKTSDMFDDEVVKEVA 413 Gibberella zeae PH-1
XP_760067 432 lsspygaghghggvrgagis----gylkdkvdhlrgvdeertrvarmqrldgkikeLQDAVTSAHDTSQAFNSEVMAEHR 507 Ustilago maydis 521
XP_503920 336 gggngilrnkle--------------------dirginhefsrrerlqklegriesLTGETNLAKTTSEAFDEQTKREIN 395 Yarrowia lipolytic...
XP_569888 379 lssghtaapvglgtylr-----------dqmdklrgtddihtrrermrkmdgkikeLQDAVTLAHETSNAFSEEVIKEHA 447 Cryptococcus neofo...
XP_452689 298 gygsgnyfkskle-------------------elaginqemarrdkiakletrvqsLTDEVEKSKQVADEFEKEVLKEVE 358 Kluyveromyces lact...
EDK40859  389 tssrpppapvashnggivnntaqlikdtlstsatptigstttegkvkklqqrvsqlEEEIEAQTAIANDLTNKVISEEYP 468 Pichia guilliermon...
Feature 1       ## ###  #  ## ### ##  ## ##  ## ##  
EDV12728  385 HFESVKTAEIKKSLGSLADHHIEFYERILEAWEKVDDS 422 Saccharomyces cerevisiae RM11-1a
XP_569888 448 YFELEKKQEMKDALQAYTDGQVEMLQQAMDDWDRIIPL 485 Cryptococcus neoformans var. neoformans JEC21

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap