Conserved Protein Domain Family
BAR_Vps5p

?
cd07627: BAR_Vps5p 
The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. Vsp5p is the yeast counterpart of human SNX1 and is part of the retromer complex, which functions in the endosome-to-Golgi retrieval of vacuolar protein sorting receptor Vps10p, the Golgi-resident membrane protein A-ALP, and endopeptidase Kex2. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153311
View PSSM: cd07627
Aligned: 15 rows
Threshold Bit Score: 258.774
Threshold Setting Gi: 164656146
Created: 5-Jun-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #  ##  ## ##  #  ##  #      ## ##  #  ##  ##               #         
NP_587929    361 EQDPILIEAKDTLDSLETQLKSVYHALLLSIDQRIQFASAIHDFGEAVGNLSLVDleptlsSKFDGLSQLQVELRFVQER 440 fission yeast
XP_001831344 432 PRFHETDEKKSYLDSLESQLRGLAKSIEFVARHRTELALATGEFATAVSDLSSSDvgkqlsHALAELAELERKAQDLQNT 511 Coprinopsis cin...
XP_570117    666 EQDDWFNSRRAFLEALESQLKSLAKAIEISSKHRVEVAISLADYAESLTALAESDlgaslsAALSQMSGLVAREGDYAEW 745 Cryptococcus ne...
CAP97565     317 EHDDWFHDRKIYLDALENQLKALLKSMDTVVLQRKGLAEAAGDFSSSLHALSAVElspalsNPLEGLSELQLRIRELYDR 396 Penicillium chr...
XP_449222    419 EPDKFFVDELDRITDLENQLKKMLKAVESIEEQRRELSSYTYDLASLIESLGALDvtkgstKLCYELAETQKRVKESLER 498 Candida glabrat...
XP_002175392 308 ETDEFLEEKKLYWEVMDAQLRSLYQTLSLVMEQRDEVGTVVSEFGESLANLSLVEldaglcSKLDALAQLQMNLHQVHER 387 Schizosaccharom...
XP_001643491 468 ESDEFFLDQYQALEILEEQLKQLYKSLELIDSERSSLTFVTEEFANSIDILAKLEvtktsaDILTNFAETHRKIKEGLER 547 Vanderwaltozyma...
XP_455828    449 EPDQFFVDAAEKMDILEEQLKQLYKALELVDSQRSDLCSVINEFSETLKALADLElsnrtsDLLQNFAEVHLRIKESTSR 528 Kluyveromyces l...
EDN63935     460 EADEFFIEKKQKIDELEDNLKKLSKSLEMVDTSRNTLAASTEEFSSMIETLASLNvsepnsELLNNFADVHKSIKSSLER 539 Saccharomyces c...
NP_984307    383 EPDTFIMEKRQHIDVMEEQLRQMYKSLELVDSQKNELVSVIKEFAATINSLVELEaskrisSILSNFAEVHLRIMESLQR 462 Ashbya gossypii...
Feature 1                                                                                        
NP_587929    441 KVAQDNLTLGTTLEEYIRYVESAKNAFTTRQKLWQTWQSSVQAVsraktqlekckkqak--sqqkslpyleeqyekYRAK 518 fission yeast
XP_001831344 512 QSEQDQSTLMATVDEYARLINSVRAAFSSRVRIYHAWKNAESDLlrtkqtheknraqgk--ipserlgyslsqiaeAERR 589 Coprinopsis cin...
XP_570117    746 HAKSEVGELLNLADEYIRFIGSVRSAFAARVDSWKVWQEKDKEVarmktarekarisgk---lgdrvqsslkeimeAERR 822 Cryptococcus ne...
CAP97565     397 QAQQDVLTLGITIDEYIRLIGSVKMAFTQRQKAFHTWHAAESDLqkrknnqdkllrqgk--tqqdrlnqisadvadAERK 474 Penicillium chr...
XP_449222    499 DALQEAITMGATLDEYVRSLASLRSIFYQRAKLGYYLVIVENDFqkkkqdvekmchnnkqpankerflaardsvknIERR 578 Candida glabrat...
XP_002175392 388 RVVHDNLTLSVTLNEYIRTAESVQNAYASRQKVWQSWQSAIAEAnrskatldkymkhgk--tqqekitnytnevneHQRV 465 Schizosaccharom...
XP_001643491 548 VSSQESLTLGITLDEYIRSLASVRAIFNQRAKLGYYLVAVRENYskadtqlnklksnssssnnidklniaseqkekLQKR 627 Vanderwaltozyma...
XP_455828    529 SSMQDSLTLGITIDDNLRAIGSVKAVLNQRKKLGYYILLVENDLnkkqtqfnkvsgnsa---nsekatsienelriLTSR 605 Kluyveromyces l...
EDN63935     540 SSLQETLTMGVMLDDYIRSLASVKAIFNQRSKLGYFLVVIENDMnkkhsqlgklgqni----hsekfremrkefqtLERR 615 Saccharomyces c...
NP_984307    463 TSLQDSLTLGVTIDEYLRSLGSIKAVFNQRAKLGYYLVIVESDLhkkqahlqklttsgk--sptdkaaaakqelanLQRR 540 Ashbya gossypii...
Feature 1                           #  ## ###  #  ## ### ##  ## ##  ## ##  
NP_587929    519 AADLEKEFSESTTLLKRDLSSLTTSRVDDLKASVETWLESAIESQKEIIERWESFLDQ 576 fission yeast
XP_001831344 590 ASEAKKEYEHVSTLVKSEVARFEQERIEDFKDTLHAFLEGMISRQKELIASWENYQQL 647 Coprinopsis cinerea okayama7#130
XP_570117    823 VHEASLEFDRLTKLVKSEFVRFERERVLEFKETLERYLNGLIEKEKEMIEGWEGLHSV 880 Cryptococcus neoformans var. neoforma...
CAP97565     475 VHQTRLLFEDMGRLMRNELQRFEKEKVEDFKSGVETFLESAVEAQKELIELWETFLLR 532 Penicillium chrysogenum Wisconsin 54-...
XP_449222    579 AITVKKAWHDIGEKIKKEVSSFDRSKMEEFRNCMEITLESAIESQKESIELWETMYHE 636 Candida glabrata CBS 138
XP_002175392 466 ASLLEADYANATKVLKSELGKIEEERVEEFKASVETWLESIIESQKEIIDRWETFLQQ 523 Schizosaccharomyces japonicus yFS275
XP_001643491 628 YLIVKSKWEQIGEKIKREFINFETDKVKEFRNSIEIFLESSIEAQKECIELWETFYQN 685 Vanderwaltozyma polyspora DSM 70294
XP_455828    606 CNKIKQEWQTIAEVIRKDVNQHDVDTIEDFRNNMEIYLESAIESQKECIEIWETFYQN 663 Kluyveromyces lactis NRRL Y-1140
EDN63935     616 YNLTKKQWQAVGDKIKDEFQGFSTDKIREFRNGMEISLEAAIESQKECIELWETFYQT 673 Saccharomyces cerevisiae YJM789
NP_984307    541 HKTIKDHWEHIAETLRDELAAYSEAKITDFRNNLEIYLESAIETQKECIELWETFYQN 598 Ashbya gossypii ATCC 10895

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap