2RAI,3DYU


Conserved Protein Domain Family
BAR_SNX9_like

?
cd07626: BAR_SNX9_like 
Click on image for an interactive view with Cn3D
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 9 and Similar Proteins
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. This subfamily consists of SNX9, SNX18, SNX33, and similar proteins. SNX9 is localized to plasma membrane endocytic sites and acts primarily in clathrin-mediated endocytosis, while SNX18 is localized to peripheral endosomal structures, and acts in a trafficking pathway that is clathrin-independent but relies on AP-1 and PACS1. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153310
View PSSM: cd07626
Aligned: 17 rows
Threshold Bit Score: 247.176
Threshold Setting Gi: 167530871
Created: 21-May-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 47 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:2RAI_AB; interface between monomers of human SNX9 dimer; defined at 4A contacts.
    View structure with Cn3D
  • Structure:3DYU_AB; interface between monomers of human SNX9 dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    #  ##  ## ##  #  ##  #       ## ##  #  ##  ##  #       #  #          
2RAI_A        191 EIEQKCEAVGKFTKAXDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSgy---qgETDLNDAITEAGKT 267  human
XP_002127441  362 DSEGPLDQFKKFTRSMDDSVSNITSCAQSMASKHYGLFKREYQSYGKSITSLSTVFNMHqt---tnNKSLTNAIKHTGQT 438  Ciona intesti...
XP_002124791  408 IAEQTLDTHSKFTRGMDEACKQLIIVGQDQAKKFPQVYKKDTQRLGQLFSTLGECFELDnr---pvSAPLTEAIKHTGQV 484  Ciona intesti...
XP_002165900  236 KVEAEVEVFKEFVKNMDDSTRKMIEIGESDWDKVSRAHRDQYKKFSSGIKALGTAFATEna---pySLALTQAMDHTAQQ 312  green hydra
XP_001748157  501 DSDKRIDQFADFVTEMLKTAKRNIDIAKAHSDRMASSFKREYTKIGSGFELLGQNFGNGggqtngdSVRLSQAFIIAADH 580  Monosiga brev...
EEB10196      339 IVEQETEDCSKFITAMDTSIKILSSTSYDQTKKYQGLYKKDYEKIGQAFQSLSYAFSLDktp-gnpRMNLTNAITTTSAI 417  human body louse
XP_001601721  334 KVEFQTDAFARFIAGLDPVVKSFMAMATDQAKKHQVLYKREFQKIGQCFVSLGNALEADdag--rsRHTLNQALKDTGEA 411  jewel wasp
XP_320759     348 LVEPQVDAATQFVPQMDTAVKTLFAICGDQSKKFQQQWKKEYQRIGEGFSEMARALAVDerr-aatQISLASSVGQAAGV 426  Anopheles gam...
XP_001898809  364 DVEQKVDTFTRSMRSFEESVHFMYNRVSETHKRLAGPYKTNWHKMGEACTGLCRSFDVNps---skNEKVTSALKETAKA 440  agent of lymp...
NP_502693     372 NVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSFEIDet---vaSRRLTEALAYTASE 448  nematode
Feature 1         #                                                                               
2RAI_A        268 YEEIASLVAEQPKKDLHFLXECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVatskiTLQDKQNXVKRVSIXSYALQA 347  human
XP_002127441  439 YHRIGDMFANQPKHDLIPFIDSLWLYKGLLDTMPDVWHMQTGAMRKLRECRKLKdegrmTDVECGAVAERADRVVCCMRA 518  Ciona intesti...
XP_002124791  485 YEAVGELYGNQPTYDWNPLLEGLNEYHGVLATFPAILGNQRNALDKLKEVRRLQlenkvTVDEMEDVATRTEKISYAVEA 564  Ciona intesti...
XP_002165900  313 YNDIGDLCADQPKKDMLHVLEVLREYTGLLSTYPEIINVHKGAFAKVKECQKLQeeeklKYAEVANVSQRMDTITCAMFA 392  green hydra
XP_001748157  581 MNGIGELCAEQPVFDQIPWMEGLKEYMGLLSQFQGCITSSRSAAARVIEVEDREd---aDSTEKEAVSSRCDIIHTLTLC 657  Monosiga brev...
EEB10196      418 YLEIGKMFEDQPKNDWEPLGDVLHIYKGIISSFPDIINVHRNTLNKHKECERLAheakmSPSELKDVKKRADVVSYALLA 497  human body louse
XP_001601721  412 YNEIGKLYEEQPKYDWEPLADKFHIYRGIISSFPDVIGIHKSAVQKRKDCERLVnehkmESAQLRELNHRTDVIARALGA 491  jewel wasp
XP_320759     427 FINIGQLFGEQPKHDFIPFSDRLHIYRGLLAAWPDTLGEYRNAVQKRKECERLTaeqkmENGQLQEVNRRVDVMSYALLA 506  Anopheles gam...
XP_001898809  441 LHWIGDEHEKLAKKSLDPLLDALYSYKGLLACIPDIVNVHRSAISKLRENEKLAiegrvSSVDMEKVKEKVDSISYMMLA 520  agent of lymp...
NP_502693     449 YHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKFRDSEGRL-----SSAEAEKMKQRIDAMSYTVIA 523  nematode
Feature 1           #  ## ###  #  ## ### ##  ## ##  ## ##  #
2RAI_A        348 EXNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRF 389  human
XP_002127441  519 EMDHFHGQRIRDFAAAQREMLQNQAQFFENIAAELRTALLQF 560  Ciona intestinalis
XP_002124791  565 EVNHFQHYRVGDFVGYMKDFVQQQISFHQEIVKKLQDTAVLY 606  Ciona intestinalis
XP_002165900  393 EIQHFHRERCRDFKEMMNNYLTEQVRFHQQIISKIQSSIAMF 434  green hydra
XP_001748157  658 EMTHFHEQRRKDFRDMMINYLDAQIDFHNKAEAGARDAGADG 699  Monosiga brevicollis MX1
EEB10196      498 EINHFHNERAVDFKGAMQSFLAEQIKFYQNIVDKLNVALSAY 539  human body louse
XP_001601721  492 EETHFQSEREIHITQAMKSHLVEQINFYQKIVDKLQEALNSF 533  jewel wasp
XP_320759     507 EMSHFREERDTHLKDTIRNFIGAQIDFYKSIVQKLEQAQTHF 548  Anopheles gambiae str. PEST
XP_001898809  521 EIAFQNRELGEDFKNMMATYLETQGEFYMNIGSQLNSLAQKF 562  agent of lymphatic filariasis
NP_502693     524 EVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKLTSLAARY 565  nematode

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap