Conserved Protein Domain Family
BAR_SNX7_30

?
cd07624: BAR_SNX7_30 
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 7 and 30
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. This subfamily consists of SNX7, SNX30, and similar proteins. The specific functions of SNX7 and SNX30 have not been elucidated. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153308
View PSSM: cd07624
Aligned: 8 rows
Threshold Bit Score: 265.783
Threshold Setting Gi: 221129269
Created: 15-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                             #  ##  ## ##  #  ##  #      ## ##  #  ##  ##              #
Q9UNH6       171 AVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEEREYFDEMKEYGPIHILWSASEEDL-VDTLKDVASCI 249 human
EEB12625     211 NNLSTMYIEARRSPELNKLNEYLTLLPDKLSHICKISQRIHKERTEEFSDLTELKSIFQYWAGSESDLtDPLCEMANAID 290 human body louse
XP_002219762 220 RSMAAGYMLKNRSPEYATMQEYVNTFGAKMGTIDRINQRLLKEMTDYQQDLREFGPVFTLWSNSETEL-APAMLGMASGV 298 Florida lancelet
XP_784282    209 RTTTTAALLRNRSPEFTVMGEYVQMLGEKLGSIERISLRILQESKDYVSELKTYSPAFRLWSNSETEL-TTPLSKMADGV 287 purple urchin
XP_967096    145 HSNSTHSALKNRHLEFDKTKSYLTVLSEKLSSIEKISSRINKERIDFIVELNSYHPIFTTWATSEPEL-AALLQNIGCAV 223 red flour beetle
NP_001013012 227 KHVTGGYKLRTRPLEFAAIGDYLDTFALKLGTIDRIAQRIIKEEIEYLVELREYGPVYSTWSALEGEL-AEPLEGVSACI 305 human
XP_002126345 200 SISTAAVRLKDRDPEFDEVLNQVTQFGEKIGVLERVAERLHAEKKEFVAELKEFSPTFSMWSASEDDViAPIMTSTSSAV 279 Ciona intestinalis
XP_002157161 228 RNTAAQFLMKNRSEEFSDVMKYNVQFQAKIKTFANITENIAEEQFYMMDDYSEYSSAFQLWANSETRL-ADTLHAVSQSF 306 green hydra
Feature 1                                                                                        
Q9UNH6       250 DRCCKATEKRMSGLSEALLPVVHEYVLYSEMLMGVMKRRDQIQAELDSKVEVLTYKKADtd------------------- 310 human
EEB12625     291 KTRQSLQNVLLNNENFVLIQPIKEYLLYIDAIKEALDNRDNIEINYLYQLDNLQRKRLEkeeleaeaidrnilkswakss 370 human body louse
XP_002219762 299 EKCEKALDQQISDQEHVFAPPVKEYILYAEAMKAVLKRRDSIQMEYELTVEDLSRKRNDre------------------- 359 Florida lancelet
XP_784282    288 EICTQSIEDQNTYQETDFLPFVKEYSLYTESIKTVLKKRDQFQMEHELAVEELNKKKNEre------------------- 348 purple urchin
XP_967096    224 ERNTAAQNMLVQSYPTVIGNPIRDFLTYIDVVQDTIKKREAYQCAYENSLEELNKRHSEkdkliasshnpsqaagfslwk 303 red flour beetle
NP_001013012 306 GNCSTALEELTDDMTEDFLPVLREYILYSDSMKSVLKKRDQVQAEYEAKLEAVALRKEDrp------------------- 366 human
XP_002126345 280 EACAEAAEANLKIHEFEYMPPLREYVLYCDVVKQVLRRRDNFQLQHDKVVAELQRKQDEkenlpksdqsysvgalmgksa 359 Ciona intestinalis
XP_002157161 307 EKNKASLKNLLRTHESRVCEPLREYLLYSDAVKDAMKRRDQFQIEQELSADELNKKRLEkeelessnaksisaffskd-p 385 green hydra
Feature 1                                                #  ## ###  #  ## ### ##  ## ##  ## ##  
Q9UNH6       311 ----------------lLPEEIGKLEDKVECANNALKADWERWKQNMQNDIKLAFTDMAEENIHYYEQCLATWESFLTS 373 human
EEB12625     371 ietrnekleklnqiipqYQQQVEEARDKLEIANENIRSDLERWNQEKKIELKKILINFAELHISHYEQCLRAWTEVDLQ 449 human body louse
XP_002219762 360 ----------------qLLKQVEVSNDSVECANADLKADLERWHRNKRRDVKEVFSELCDRNIQYYQECLSAWEETLQE 422 Florida lancelet
XP_784282    349 ----------------qLQKEVEVFSDRAECANADLKADMERWHHNRRKDMKDMLSGMAYQQIMSNTGVSLIIILLSGM 411 purple urchin
XP_967096    304 qpscdekleklgvyipqLLKKVEANQDSLECANESLRSDIEHWQLEKQQCLKKILLDFVNKQIEYYQATVNAWEHVTSE 382 red flour beetle
NP_001013012 367 ----------------kVPADVEKCQDRMECFNADLKADMERWQNNKRQDFRQLLMGMADKNIQYYEKCLMAWESIIPL 429 human
XP_002126345 360 nevkdqkelkleqqieeISKRRDDLNDKLECANANLRSDVDRWKVDKLHDMAQIFDDLADSQIQFHQQCLSAWEHILPA 438 Ciona intestinalis
XP_002157161 386 ekareekisklnqqikeLLLESDLLSDRREKADHDFKADLERWEKTKKRDLKELFLDIAERHIKFYEANTAAWQEAYEA 464 green hydra

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap