Conserved Protein Domain Family
BAR_SNX4

?
cd07622: BAR_SNX4 
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 4
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. SNX4 is involved in recycling traffic from the sorting endosome (post-Golgi endosome) back to the late Golgi. It is also implicated in the regulation of plasma membrane receptor trafficking and interacts with receptors for EGF, insulin, platelet-derived growth factor and leptin. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153306
View PSSM: cd07622
Aligned: 11 rows
Threshold Bit Score: 273.492
Threshold Setting Gi: 167538129
Created: 15-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                              #  ##  ## ##  #  ##  #      ## ##  #  ##  ##             #
NP_003785    205 KALNATFRVK-NPDKRFTDLKHYSDELQSVISHLLRVRARVADRLYGVYKVHGNYGRVFSEWSAIE-KEMGDGLQSAGHH 282 human
XP_970429    176 KALNLSMRLR-NTDPRFESIKDYSHVFQNNLNNLLKARSRVAEKQYNVHKLHANYGRVFSEWSAVE-KDMGDALQKTGHY 253 red flour beetle
EEB15837     179 KALAALPSRIkKPDERFEALKDYSNELNTHLQNLLKTRTRLAERYYTIYKLHANYGRVFSEWSAAE-KTMGDGLQKAGHF 257 human body louse
XP_001626045 171 RSLSASMSLK-KPDRRFEDMKHYADNLGTSVASMLKVRQHIIESTFSLHKNHAGYGKTLSEWSTLE-KEMGDGLQKAGHY 248 starlet sea ane...
XP_002218473 150 KTLNAQFRLK-NPDRRFQDLKNYSSELEANIANLLKIRERLAERLYGIHKIHANYGRVFSEWSGIE-KEMGDGLQSAGHF 227 Florida lancelet
XP_422107    190 KALNATFRVK-NPDKRFTELKHYSDELQSVISHLLRVRARVADRLYGVYKVHGNYGRVFSEWSAIE-KEMGDGLQSAGHH 267 chicken
XP_397464    166 KALSVAVRLR-KPDKRFEAIKNYGIELQNNLCNLLRVRARLVEKQHSLYKLHANYGRVFSEWSAIE-REMGDGLQKSGHY 243 honey bee
NP_001014368 189 KALNATFRVK-NPDKRFAEMKHYGDELQAVVSQLLRVRARAADRLYGVYKVHGNYGRVFSEWSAIE-KEMGDGLQSAGHH 266 zebrafish
XP_001948366 165 KTMNASLRGR-NSDKRFEEIKTYSNKLQGSINKILTYRAKQAERLYNVDMIHLHYGRIFSELSAVD-NDIGDAVQRTGHY 242 pea aphid
XP_002119505 190 KKVNASLRVR-EPNLRYEQLKCYANNLQTNATALLKVRAKLAERVYGIYKIHSNYSRVFKEWALVEdSPLKEALQKSSID 268 Ciona intestinalis
XP_001750730 164 KSLSAVFAGD-TGHRQFRDLHNYADVLQEHLVGLLAVHGRLAQNTQRLTVAFEELGMAFDDWSRIE-VTLAEDLAEICRL 241 Monosiga brevic...
Feature 1                                                                                        
NP_003785    283 MDVYASSIDDILEDEEHYADQLKEYL-FYAEALRAVCRKHELMQYDLEMAAQDLASKKQQceelvtgtvrtfslkgmttk 361 human
XP_970429    254 LDSLASSIDAGLEDEELLVDQLKEYL-FFANSLQNVCKNYEYHQLQLESAEDNVASKNVErnkaqqgktslmsrlfgav- 331 red flour beetle
EEB15837     258 LDSFAASIDLASEEEEVIADQLKQYL-FFGASVQAVCKRRDMLQLQLQRAQDYIDDRVNQmeqvqkgkvsfmsrifgtt- 335 human body louse
XP_001626045 249 MDRLSASVDNVLEDDELTFADPLKEYqLFADVLKMVAKKQWLRQYDLEKAEEALSAKNKQrqdletqkqavaaatpvpkt 328 starlet sea ane...
XP_002218473 228 MDVYAASIDSMLEEEDTYADALKEYL-YFADALRSICRKQELLQYEVEKLEDKLVYLKAQkeqmeqggdvksgfslkgmt 306 Florida lancelet
XP_422107    268 MDVYAASIDDILEEEEHYADQLKEYL-FYAEALRAVCRKHELMQYDLEMAAQDLTSKKQQceelatgtvrtfslkgmtsk 346 chicken
XP_397464    244 LDSLAATIDTTLEEEELIADQLKEWL-FGASALQAVIKRREALQLAKDETHDALTTAFELfvsvdteevrel-------- 314 honey bee
NP_001014368 267 MDAYAASIDDILEEEEHYADQLKEYL-FYADALRAVCRKHELTQYELETAVQDLSSKKQQreelatgtvrtfslkgmtsk 345 zebrafish
XP_001948366 243 MDSIASAISPALEDEEVIMDQLKEYL-AFTNSLHTFVKNHDLLHYNLNQLNNMSNKTSGImsrlfgytaaa--------- 312 pea aphid
XP_002119505 269 VDAYGISIDNLIDEEDQIAEQLKEYL-YFADSLKTICKKHEALQYDVEWYESSLANALTEkkqllsgppktfsfsglkar 347 Ciona intestinalis
XP_001750730 242 FDRQAERLINGLRDEERFADCVKVFS-GYGDSLRAVVSHQQVLHGKVAKAEQAKLNKQQQlealdttsdsgisgffsrlt 320 Monosiga brevic...
Feature 1                                                                 #  ## ###  #  ## ### ##
NP_003785    362 lf-----------gqetpeqrearikvleeqineGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKEALISYAVMQI 430 human
XP_970429    332 ---------------dtdevrelkvnlldqqiqeGAAAVNVSKTNLNDFSTKALDDIERFQKQKVVDLQETLTSYAFLQL 396 red flour beetle
EEB15837     336 ---------------drletkelrvnaveqriqeGKINMKAIVDELNDFTKEALLDYERFDKQKTLDVKETLGNYVGIQI 400 human body louse
XP_001626045 329 snfsfkglssmifgaethdtlegkssvldeqiqeAEAAVEAKRDDLELFVKDVMTDYERFKRQEVRDLKAILAAHVKTQI 408 starlet sea ane...
XP_002218473 307 tkl---------fgadtpetrdkkiklleeqtqqTEEQLQAAKWELSTYIDRSLQDVERFKRQKVRDLREIFINYSIMQI 377 Florida lancelet
XP_422107    347 lf-----------gqetpeqreakikvleeqiqeGEEQLKSKNLEGRDFVKSAWADIERFKEQKNHDLKEALISYAVMQI 415 chicken
XP_397464    315 -----------------------kmlqleqriaqHEEAVKRADEDLKSFSIKAMMDIERFQHQKVVDLKEILAAYCILQF 371 honey bee
NP_001014368 346 lf-----------gqetpeqreaklkmletqieeGEEMVKDRNVECEEFVKGAWTDIERFKEQKDHDLREALISYAIMQI 414 zebrafish
XP_001948366 313 ------------------------adrdtaaieaFENKKIEAKANYSEFVDKSLENYKQFERQKDSDLMNILKDYVAFQT 368 pea aphid
XP_002119505 348 ll-----------gadaadvtetrlevletnitdLEKDLEKHRMIAKEFLDEADEEVELFKTRKVMDLREIFVSYAVLQI 416 Ciona intestinalis
XP_001750730 321 g-------------pstpeareelrtkltaelqaLTTEASEQERCNNEFVQAALGEVDRFQKFKQRELILMFLSFAKVQQ 387 Monosiga brevic...
Feature 1          ## ##  ## ##    
NP_003785    431 SMCKKGIQVWTNAKECFS 448 human
XP_970429    397 KTAKKGLQTWLQIRDCLQ 414 red flour beetle
EEB15837     401 KLSKQGLQTWTHVKECLN 418 human body louse
XP_001626045 409 KLCKMGMSTWQNMKETAQ 426 starlet sea anemone
XP_002218473 378 KLCKKGISLWNNTKECFT 395 Florida lancelet
XP_422107    416 SMCKKGIQVWTNAKECFG 433 chicken
XP_397464    372 KLARKGLQAWQHIKSCLE 389 honey bee
NP_001014368 415 SMCKKGIQVWNNAKECFS 432 zebrafish
XP_001948366 369 KYAQKGLQTWKNILQSIQ 386 pea aphid
XP_002119505 417 KMNKEGAAYWKKIKTPFA 434 Ciona intestinalis
XP_001750730 388 AYAQAHVRLWTKVQTVLT 405 Monosiga brevicollis MX1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap