Conserved Protein Domain Family
BAR_SNX5_6

?
cd07621: BAR_SNX5_6 
The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 5 and 6
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. Members of this subfamily include SNX5, SNX6, the mammalian SNX32, and similar proteins. SNX5 and SNX6 may be components of the retromer complex, a membrane coat multimeric complex required for endosomal retrieval of lysosomal hydrolase receptors to the Golgi, acting as a mammalian equivalent of yeast Vsp17p. The function of SNX32 is still unknown. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153305
View PSSM: cd07621
Aligned: 17 rows
Threshold Bit Score: 288.074
Threshold Setting Gi: 193209152
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                       #  ##  ## ##  #  ##  #                           
Q9UNH7       186 DFFKNMVKSAd-GVIVSGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAAD--------------------- 243 human
XP_002130614 201 GFFKNITKTAdeTLLLSGQKDSDEFFEHEKSFMSEYHIRIKDATLKIDKVTITHKKCAN--------------------- 259 Ciona intestinalis
XP_001638873 174 GLFKGLAKGVd-EVLLSGQKDVDEFFESEKKFLVEYHNKLKDSVRKGDVMTRSHKNCAD--------------------- 231 starlet sea ane...
EEC00832     184 GLLTNIGKSAddLRLSSTQKDVDEFFEHERTFLVEYHTHIRDATAKSDKMTRAHKNVAD--------------------- 242 black-legged tick
NP_001088935 181 VFFKNMVKSAd-EMLFSGVKEVDEFFEQEKTFLVNYYNRIKDSCAKADRMTRTQKTVAD--------------------- 238 African clawed ...
XP_002214800 187 WFIKSMSQSVd-EVLLSNQKDADEFFEQEKGFLVEYHNRIAQSTKCADRMTKMHKSVAD--------------------- 244 Florida lancelet
XP_791140    191 GLMKFVTKSVd-EVLVSGQKDVDSFFEHEKNFLVEYHNKVKDATMKSDKMTRSHKDVAD--------------------- 248 purple urchin
XP_002113191 153 SVLRNDSNFR--VFLEYNGDDADDFFENEKRFLVDYHTRVKEALKASDKMTISHKGTAG--------------------- 209 Trichoplax adha...
XP_002158354 185 GIAKGIAKGVdeKLLLSGQKDIDEFFENEKKFQVDFFNRIKDAAAKCDKMTSTHKKMAD--------------------- 243 green hydra
NP_507518    257 SFWKRFTQSAd-EVLLSGQKDVDEFFEKEKNYMVEYNIHIKEAAAKSEKLIAARKIEKLnfywiklenfeqnteisvlkk 335 nematode
Feature 1                                                             ## ##  #  ##  ##           
Q9UNH7       244 -----------------------------------------------------DYNRIGSSLYALGTQDS-------TDI 263 human
XP_002130614 260 -----------------------------------------------------DYSHIAMALQSLATVENsiamshkKGL 286 Ciona intestinalis
XP_001638873 232 -----------------------------------------------------VYIKISTGIASMGTSEY-------TGL 251 starlet sea ane...
EEC00832     243 -----------------------------------------------------SYIKISSCLTQLATVES-------SEL 262 black-legged tick
NP_001088935 239 -----------------------------------------------------DYIHISAALTCVAEEES-------TPV 258 African clawed ...
XP_002214800 245 -----------------------------------------------------SYIKLSTGLGSLATCEN-------TEL 264 Florida lancelet
XP_791140    249 -----------------------------------------------------TYIKISGGLLGLGTIDK-------TEL 268 purple urchin
XP_002113191 210 -----------------------------------------------------CYLSIGSATNQMGTSEP-------TSL 229 Trichoplax adha...
XP_002158354 244 -----------------------------------------------------AIIKIAAELGEMGTSEN-------SNL 263 green hydra
NP_507518    336 weklalkeirvlllnifyrkivekcsfldnffatvtvtfifgeifkitedvvaSFSKIGDSFERIARGEPn------KSL 409 nematode
Feature 1                  #                                                                     
Q9UNH7       264 CKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKnkdvlqAETS 343 human
XP_002130614 287 DRSLLKVHESLEKVRKLEARAASDVDLKLADLLRYYFRDTQACKDLLYRRARTLANYENANKELDKARSRgknvpqAEAQ 366 Ciona intestinalis
XP_001638873 252 DKFLNKTGDYFERARKLEGRVASDEDLKMVDLLRYYMRDTEAAKNLLHRRAKCLAEYENANKALDKARMKnk--eiAESA 329 starlet sea ane...
EEC00832     263 EKFFPKVSESFEKARKIEGRVATDEDLKLSDTLRYYMRDTSAAKDLLYRRLRCLANYENANRALERARNKnkdvqaAEVL 342 black-legged tick
NP_001088935 259 RKYLLKLAELFEKLRKVEARVASDQDLKLSELLRYYMLNIEAAKDLLHRRTKSLADYENSNKALDKARLKskdvkqAEQH 338 African clawed ...
XP_002214800 265 DKVFNKVSECFEKSRKLEARVSSDEDLKLSDTLRYYLRDTSAAKDLLYRRTRALADYENANKDLDKARAKnrnvqqAEQA 344 Florida lancelet
XP_791140    269 DKFFIKIAETFEKLRKLEARVASDEDLKQSDLLRYYMRDSSAAKDLLYRRMRALVNYQNANKALEKARMKnkdvhaAERN 348 purple urchin
XP_002113191 230 NKFLSRFGGLIEKYRKIDNRVVADEDLKLSDILRYYARDLSSAKDLLYRRSRCVSSYENANKGLEKARNKnkdvqtAEKV 309 Trichoplax adha...
XP_002158354 264 HSVLTKASESLEKLRKLEGRMATDEDLKLGDLLKYHMRDTEAAKGLLYRRMRSLANLENANKNLDKARAKnkdvmaATSM 343 green hydra
NP_507518    410 ARTFAQGADAMFKLKKVESRSSNDEELKLGDTLHYFARDTQAAKDLLYRRMRCLANYEAANKNLERARAKnreipkAEAE 489 nematode
Feature 1                           #  ## ###  #  ## ### ##  ## ##   ## ##    
Q9UNH7       344 QQLCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQL-LQNCLAVLN 403 human
XP_002130614 367 QKTAREKFEVLSEVGKQELTEFKGRRVTAFRKNLIELGELQLKHSKAMVQV-LKGCISTIE 426 Ciona intestinalis
XP_001638873 330 QQNASEKFEHMSEIARQELTDFKARRVQQFRKNLTELVELELKHAKAHHQL-LKNTIAALE 389 starlet sea anemone
EEC00832     343 QQEACESFENISKQAKQELTDFKTRRVNNFRKNLIELAELELKHAKAQVQL-LKSSIALVK 402 black-legged tick
NP_001088935 339 QQESCQKFEKLSESAKQELVGFKRRRVAAFRKNLVEMTELEIKHAKNNISL-LQSCIDLFK 398 African clawed frog
XP_002214800 345 QQRACEKYEHLSELAKSELQDFKKRRVGAFRKNLVELAELEIKHAKALNQL-YRNCIAQLK 404 Florida lancelet
XP_791140    349 QTEACEKFEKMSDVAKGELTDFKARRVVAYRKNLTELAELELKHAKAQVQL-LRNTLASLK 408 purple urchin
XP_002113191 310 QQAAREKFENMSEIAKQELLDFKQKRVTAFKRNLSELAELELKHAKIAAQL-FRNTISALK 369 Trichoplax adhaerens
XP_002158354 344 QQTANEKFVALSDTAKIELADLKKKKVSHFRKNLIELAELELKHAKVNANQyNEDANGNSK 404 green hydra
NP_507518    490 QSEACKKFEEITGLSKNELKELKTRRVQAFKKNLTDLAELEIKHSKAEISL-LRDVVERLK 549 nematode

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap