Conserved Protein Domain Family
BAR_SH3BP1

?
cd07620: BAR_SH3BP1 
The Bin/Amphiphysin/Rvs (BAR) domain of SH3-domain Binding Protein 1
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. SH3-domain binding protein 1 (SH3BP1 or 3BP-1) is a Rac GTPase activating protein that inhibits Rac-mediated platelet-derived growth factor (PDGF)-induced membrane ruffling. SH3BP1 contains an N-terminal BAR domain followed by a GAP domain for Rho and Rac GTPases and a C-terminal proline-rich domain. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153304
View PSSM: cd07620
Aligned: 4 rows
Threshold Bit Score: 391.998
Threshold Setting Gi: 118082746
Created: 3-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                #  ##      # ##  ## ##                           ## ##  ## ##  #        
NP_061830     16 GSLGRTPETAEFLGEDLLQVEQRLEPAKRAAHNIHKrlqaclQGQSGADMDKRVKklPLMALSTTMAESFKELDPDssmg 95  human
CAG04502      13 GSASKSQDATELLHEDLVLVEQRVEPAKKAAQLIHKklqgcmQSQPGLEAEKRMKklPLMLLSISMAESLKDFDAEssir 92  spotted green p...
XP_001345357   1 MATPVSQDATDLLTDDLVLVEQRVEPAKKAAQIIHKklvgclQSQQGLDSERRMKklPLMMLSVSMAESIKDFDGDssir 80  zebrafish
XP_428489      1 MGLQVAQEATEFLTEDLLQIEQRIEPAKRAAHTVSKrlqaclQGHCGTEIDKRVKklPLMALSATMAESFKELDTEsslg 80  chicken
Feature 1             #  ##                                                                      
NP_061830     96 kaleMSCAIQNQLARILAEFEMTLERDVLQPLSRLSe-----------------------eELPAILKHKKSLQKLVSDW 152 human
CAG04502      93 rvleMCCFMEKMLANMLADYEMKVEKAVLEPLNKLSevgvtpstrwqsgqkikqfcfpsqeDLPEILRNKKQFAKLTTDW 172 spotted green p...
XP_001345357  81 kvleMCCFMQNTLAQTLADFEMKLEKEVLVPLNKLSe-----------------------eDLPEILKNKKQFAKLTTDW 137 zebrafish
XP_428489     81 raleMGCCIQSSLAKILAEFEIPVERDVLQPLNKLSe-----------------------eELPIILKHKKTLQKLISDW 137 chicken
Feature 1                                                                      #  ## #   #  ## ##
NP_061830    153 NTLKSRLSQatknsgssqglg-gspgshshttmaNKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEdSYANYFIRLL 231 human
CAG04502     173 NSAKIRSPGkagraprgggrsleevgehqgirrpSPGDPVWPLLGDCWPLLLCPQDQYSADLYHFATKEqEYANYFIQFI 252 spotted green p...
XP_001345357 138 NNARTRSETstg--------------------pqAKQHGLREDVEEAWRRLESIKDQYSADLYHFATKEdDYASYFTRLL 197 zebrafish
XP_428489    138 NAIKSRLNQaaksssnsaga----gagpgassaaNKLEILKEEEEEVKRKVEQCKDEYMADLYHFSTKEdSYASYFIRLL 213 chicken
Feature 1          ##  ## ##  ## ##                       
NP_061830    232 EIQADYHRRSLSSLDTALAELRENHGQADHSPSMTATHFPR 272 human
CAG04502     253 ELQAEYHKNSHEFLSKNISELKDNYLQKGPPVSVSSQRVYG 293 spotted green pufferfish
XP_001345357 198 ELQAEYHKASYDFLERNITELKESHSHTEPLVSSSENKVFG 238 zebrafish
XP_428489    214 EIQAQYHRQSLESLDSALTELKESHSQKEPSFTTETPVLGY 254 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap