2Z0V


Conserved Protein Domain Family
BAR_Endophilin_A3

?
cd07615: BAR_Endophilin_A3 
Click on image for an interactive view with Cn3D
The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A3
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Endophilins are accessory proteins localized at synapses that interacts with the endocytic proteins, dynamin and synaptojanin. They are essential for synaptic vesicle formation from the plasma membrane. They interact with voltage-gated calcium channels, thus linking vesicle endocytosis to calcium regulation. They also play roles in virus budding, mitochondrial morphology maintenance, receptor-mediated endocytosis inhibition, and endosomal sorting. Endophilins contain an N-terminal N-BAR domain (BAR domain with an additional N-terminal amphipathic helix), followed by a variable region containing proline clusters, and a C-terminal SH3 domain. They are classified into two types, A and B. Endophilin-A proteins are enriched in the brain and play multiple roles in receptor-mediated endocytosis. Endophilin-A3 (or endophilin-3) is also referred to as SH3P13 (SH3 domain containing protein 13) or SH3GL3 (SH3 domain containing Grb2-like protein 3). It regulates Arp2/3-dependent actin filament assembly during endocytosis. It binds N-WASP through its SH3 domain and enhances the ability of N-WASP to activate the Arp2/3 complex. Endophilin-A3 co-localizes with the vesicular glutamate transporter 1 (VGLUT1), and may play an important role in the synaptic release of glutamate.
Statistics
?
PSSM-Id: 153299
View PSSM: cd07615
Aligned: 4 rows
Threshold Bit Score: 396.31
Threshold Setting Gi: 188036175
Created: 1-Jun-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 47 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:2Z0V; interface between monomers of human Endophilin-A3 BAR domain dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                     ##  ## ##  ##  #   #  ##                           ## ##  ##  #  ##
2Z0V_A         9 EGTKLDDEFLDXERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGXLNTVSKIRGQVKTTGYPQTEGLLGDCXLKYGKEL 88  human
NP_989859     25 EGTKLDEEFQEMERKIDVTNKAVAELLSKSTEYLQPNPAYRAKLGMLNTMSKIRGQVKTTGYPQTEGLLGDCMIRYGREL 104 chicken
NP_001075160  25 EGTKLDEDFMEMERKIEVTNKSVFELITKTTEYLQPNPASRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLRYGREL 104 zebrafish
NP_001088468  25 EGTKLDDDFQEMERKIDITNKVVAELLSKTTEYLQPNPAYRARLGMLNTMSKIRGQVKTTGYPQTEGLLGDCMLRHGREL 104 African clawed ...
Feature 1           ###  ##                                                                      
2Z0V_A        89 GEDSTFGNALIEVGESXKLXAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKipDEEVR 168 human
NP_989859    105 GDDSMFGLALLDAGESMKQMAEVKDSLDINVKQNFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRLGKipDEEVK 184 chicken
NP_001075160 105 GEESAFGTALADIGEAMKQMADIKDALDISVKQNFIDPLQNLQDKDLKEIVHHLKKLEGRRLDFDYKKKRQGKipDEEIK 184 zebrafish
NP_001088468 105 GEESEFGCALLDGGECMKQMAEVKDSLDINVKQNFIDPLQSLQDKDLKEILYHLKKLEGRRLDFDYKKKRQGKipDEEIR 184 African clawed ...
Feature 1                               ## ### ##  #  ## ### ##  ## ##  #   #   
2Z0V_A       169 QAVEKFEESKELAERSXFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQXRISAA 231 human
NP_989859    185 QAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHKQSTEILEDLQSKLQNRINVA 247 chicken
NP_001075160 185 QAVEKFEESKELAERSMFNFLENDVEQVSQLSALIEAALEYHRQSLEILKDLDSKLQNRISTA 247 zebrafish
NP_001088468 185 QAVEKFEESKELAERSMFNFLENDIEQVSQLSVLVETALDYHRQSAQILEDLHNRLHNRINTA 247 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap