Conserved Protein Domain Family
BAR_Endophilin_A2

?
cd07614: BAR_Endophilin_A2 
The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A2
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Endophilins are accessory proteins, localized at synapses, which interact with the endocytic proteins, dynamin and synaptojanin. They are essential for synaptic vesicle formation from the plasma membrane. They interact with voltage-gated calcium channels, thus linking vesicle endocytosis to calcium regulation. They also play roles in virus budding, mitochondrial morphology maintenance, receptor-mediated endocytosis inhibition, and endosomal sorting. Endophilins contain an N-terminal N-BAR domain (BAR domain with an additional N-terminal amphipathic helix), followed by a variable region containing proline clusters, and a C-terminal SH3 domain. They are classified into two types, A and B. Endophilin-A proteins are enriched in the brain and play multiple roles in receptor-mediated endocytosis. Endophilin-A2 (or endophilin-2) is also referred to as SH3P8 (SH3 domain containing protein 8) or SH3GL1 (SH3 domain containing Grb2-like protein 1). It localizes to presynaptic nerve terminals and forms heterodimers with endophilin-A1 through their BAR domains. Endophilin-A2 binds dynamin 1, synaptojanin 1, and the beta1-adrenergic receptor cytoplasmic tail through its SH3 domain.
Statistics
?
PSSM-Id: 153298
View PSSM: cd07614
Aligned: 3 rows
Threshold Bit Score: 409.488
Threshold Setting Gi: 119589633
Created: 1-Jun-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interfaceputative
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  ##  ## ##  ##  #   #  ##                           ## ##  ##  #  ##
NP_989860  25 EGTKLDDDFKEMEKKVDLTSKAVTEVLTRTIEYLQPNPASRAKLTMLNtmskirgqvKNPGYPQSEGLLGESMIRYGKEL 104 chicken
EAW69227   25 EGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNtvskirgqvKNPGYPQSEGLLGECMIRHGKEL 104 human
AAI06272   25 EGTKLDDDFKEMEKKVDLTTKAVADVLAKTIEYLQPNPASRAKLSMLNtvskirgqvKNPGYPQPEGVLGETMVKYGKDL 104 African clawed frog
Feature 1        ###  ##                                                                      
NP_989860 105 GEDSNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKipDEELR 184 chicken
EAW69227  105 GGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKipDEELR 184 human
AAI06272  105 GDESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFLDPLQNLCDKDLKEIQHHLKKLEGRRLDYDYKKKRQGKipDEELR 184 African clawed frog
Feature 1                            ## ### ##  #  ## ### ##  ## ##  #   #   
NP_989860 185 QAMEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREA 247 chicken
EAW69227  185 QALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREA 247 human
AAI06272  185 QAMEKFIESKEVAETSMINLIDTDVEQVSQLSALVEAQLEYHRQAVQILDELSDKLKNRMRES 247 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap