1ZWW,1X03


Conserved Protein Domain Family
BAR_Endophilin_A1

?
cd07613: BAR_Endophilin_A1 
Click on image for an interactive view with Cn3D
The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A1
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Endophilins play roles in synaptic vesicle formation, virus budding, mitochondrial morphology maintenance, receptor-mediated endocytosis inhibition, and endosomal sorting. Endophilins contain an N-terminal N-BAR domain (BAR domain with an additional N-terminal amphipathic helix), followed by a variable region containing proline clusters, and a C-terminal SH3 domain. They are classified into two types, A and B. Vertebrates contain three endophilin-A isoforms. Endophilin-A proteins are enriched in the brain and play multiple roles in receptor-mediated endocytosis. Endophilin-A1 (or endophilin-1) is also referred to as SH3P4 (SH3 domain containing protein 4) or SH3GL2 (SH3 domain containing Grb2-like protein 2). It is localized in presynaptic nerve terminals. It plays many roles in clathrin-dependent endocytosis of synaptic vesicles including early vesicle formation, ubiquitin-dependent sorting of plasma membrane proteins, and regulation of calcium influx into neurons. The BAR domain of endophilin-A1 forms crescent-shaped dimers that can detect membrane curvature and drive membrane bending, while its SH3 domain binds the endocytic proteins, dynamin 1, synaptojanin 1, and amphiphysins.
Statistics
?
PSSM-Id: 153297
View PSSM: cd07613
Aligned: 5 rows
Threshold Bit Score: 382.43
Threshold Setting Gi: 99031622
Created: 1-Jun-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 47 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:based on the structures of Endophilin-A1 and -A3 BAR domain dimers
  • Structure:1ZWW; interface between monomers of Mus musculus Endophilin-A1 BAR domain dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                     ##  ## ##  ##  #   #  ##                           ## ##  ##  #  ##
1ZWW_A        25 EGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKlsmintmskirgqekgpgYPQAEALLAEAMLKFGREL 104 house mouse
1X03_A        30 EGTKLDDDFKEXERKVDVTSRAVXEIXTKTIEYLQPNPASRAKlsxintxskirgqekgpgYPQAEALLAEAXLKFGREL 109 human
NP_001089516  25 EGTKLDEDFKEMERKVDTTSKAVMEIMTKTTEYLQPNPASRAKltmlntmskirgqekgpgYPQAEALLAEAMFKFGKEI 104 African clawed ...
NP_989861     25 EGTKLDDDFKEMERKVDVTSRAVMEIMAKTIEYLQPNPASRAKlsmintmskirgqekgpgYPQAEALLADAMLKFGREL 104 chicken
NP_957410     25 EGTKLDVDFTEMEKKVDTTSRAVLDILTKTTEYLQPNPATRAKmsmmssmskirggdkgpgYTQTETTLGEAMQKAGREL 104 zebrafish
Feature 1           ###  ##                                                                      
1ZWW_A       105 GDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFGYKKKRQGKipDEELR 184 house mouse
1X03_A       110 GDDCNFGPALGEVGEAXRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKipDEELR 189 human
NP_001089516 105 GDESNFGLALLDVGEAMRELSDIKDSLDIDVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKitDDEIR 184 African clawed ...
NP_989861    105 GEECNFGPALADVGEAMKELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKMEGRRLDFDYKKKRQGKlpDEELR 184 chicken
NP_957410    105 GEESCFGVALIDVGEAMRELGEVKDALDMEVKQNFIDPLQNIHDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKvtEDEIK 184 zebrafish
Feature 1                               ## ### ##  #  ## ### ##  ## ##  #   #   
1ZWW_A       185 QALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA 247 house mouse
1X03_A       190 QALEKFDESKEIAESSXFNLLEXDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA 252 human
NP_001089516 185 QALEKFDESKEIAESSMFNLLEMDIEQVNQLSALAQAQLEYHRQATQILQHVAVKLEQRVRDA 247 African clawed frog
NP_989861    185 QALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQATQILQRVTSKLEDRIKEA 247 chicken
NP_957410    185 QALEKFDDSKEIAEQSMFNLLENDIEQVSQLSALVQAQVNYHRQAAEILQQLSSKIEDRIREA 247 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap