2FIC


Conserved Protein Domain Family
BAR_Amphiphysin_I_II

?
cd07611: BAR_Amphiphysin_I_II 
Click on image for an interactive view with Cn3D
The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysin I and II
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Amphiphysins function primarily in endocytosis and other membrane remodeling events. They contain an N-terminal BAR domain with an additional N-terminal amphipathic helix (an N-BAR), a variable central domain, and a C-terminal SH3 domain. Amphiphysin I proteins, enriched in the brain and nervous system, contain domains that bind clathrin, Adaptor Protein complex 2 (AP2), dynamin and synaptojanin. They function in synaptic vesicle endocytosis. Some amphiphysin II isoforms, also called Bridging integrator 1 (Bin1), are localized in many different tissues and may function in intracellular vesicle trafficking. In skeletal muscle, Bin1 plays a role in the organization and maintenance of the T-tubule network. The N-BAR domain of amphiphysin forms a curved dimer with a positively-charged concave face that can drive membrane bending and curvature. Human autoantibodies to amphiphysin-1 hinder GABAergic signaling and contribute to the pathogenesis of paraneoplastic stiff-person syndrome. Mutations in amphiphysin-2 (BIN1) are associated with autosomal recessive centronuclear myopathy.
Statistics
?
PSSM-Id: 153295
View PSSM: cd07611
Aligned: 5 rows
Threshold Bit Score: 391.223
Threshold Setting Gi: 119389482
Created: 20-May-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceputative
Conserved site includes 36 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                           #  ##   #  #  ##  #         ## ##  ## ##  #       #          
2FIC_A        41 QKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWpGRDEANKIAENNDLL 120 human
NP_001004398  26 QKLGKADETKDEQFEEYVQNFKRQEAEGSRLQRELRAYLAAIKGMQDASKKLTESLHEVYEPDWyGREDVKMIGEKCDEL 105 chicken
NP_001085079  30 QKLGKADETKDEQFEEYVQNFKRQETEGTRLQREMRAYLAAIKGMQEASLKLSESLHEVYEPDWyGRDDVKTVGEKCDTL 109 African clawed ...
NP_957125     26 QKLGKADETKDEQFEQCVQNFKRQEFEGSRLQREMKAYIAAVKGMQQASMNLTESLHEVYEPDWhGKDDVMTIGKNCDAL 105 zebrafish
AAC02977      26 QKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWyGREDVKMVGEKCDVL 105 human
Feature 1                                                                                        
2FIC_A       121 WMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAkkkDEAKIAKAEEELIKAQKVFEEMNV 200 human
NP_001004398 106 WEDFHQKLVDGSLLTLDTYLGQFPDIKTRIAKRSRKLVDYDSARHHLEALQSSkrkDEGRITKAEEEFQKAQKVFEEFNT 185 chicken
NP_001085079 110 WEDFHQKLVDGALITLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQNAkrkDEGRISKAEEEFQKAQKVFEDFNI 189 African clawed ...
NP_957125    106 WEDFHQKLVDSTINTLETYLTQFPDLKVRVAKRSRKLIDYDSARHHLETLQTStmrNEKRIAKAEEDLKKAQRVFDDLNV 185 zebrafish
AAC02977     106 WEDFHQKLVDGSLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSkrkDESRISKAEEEFQKAQKVFEEFNV 185 human
Feature 1              #  ## #    ## ##  ## ##  ## ##   #  #        
2FIC_A       201 DLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEK 251 human
NP_001004398 186 DLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIALLCHKLYEVMTKLGD 236 chicken
NP_001085079 190 DLQEELPSLWSRRIGFYVNTFQNVSGLEAKFHKEITVLCHKLYEVMTKLGE 240 African clawed frog
NP_957125    186 GLQDELPTLWDSRVGFYVSTFKNVSSLEARFHREISFLCHKLYEVMNKLAE 236 zebrafish
AAC02977     186 DLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGD 236 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap