2D1L,1Y2O


Conserved Protein Domain Family
I-BAR_IMD

?
cd07605: I-BAR_IMD 
Click on image for an interactive view with Cn3D
Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), a dimerization module that binds and bends membranes
Inverse (I)-BAR (or IMD) is a member of the Bin/Amphiphysin/Rvs (BAR) domain family. It is a dimerization and lipid-binding module that bends membranes and induces membrane protrusions in the opposite direction compared to classical BAR and F-BAR domains, which produce membrane invaginations. IMD domains are found in Insulin Receptor tyrosine kinase Substrate p53 (IRSp53), Missing in Metastasis (MIM), and Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-like (BAIAP2L) proteins. These are multi-domain proteins that act as scaffolding proteins and transducers of a variety of signaling pathways that link membrane dynamics and the underlying actin cytoskeleton. Most members contain an N-terminal IMD, an SH3 domain, and a WASP homology 2 (WH2) actin-binding motif at the C-terminus, exccept for MIM which does not carry an SH3 domain. Some members contain additional domains and motifs. The IMD domain binds and bundles actin filaments, binds membranes and produces membrane protrusions, and interacts with the small GTPase Rac.
Statistics
?
PSSM-Id: 153289
View PSSM: cd07605
Aligned: 9 rows
Threshold Bit Score: 227.249
Threshold Setting Gi: 116666967
Created: 13-May-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interface
Conserved site includes 46 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:2D1L; interface between monomers of Mus musculus IMD domain of MIM dimer; defined at 4A contacts.
    View structure with Cn3D
  • Structure:1Y2O; interface between monomers of the human IRSp53 IMD domain dimer; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 ##       #  ##  #  ##  #  ## ##   # ##  ## ##  ##         #   #         
2D1L_A         13 SALGGLFQTIISDXKG-SYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADXAtntrggtreIGSALTRXCXRHRS 91   house mouse
1Y2O_A          7 EEXHRLTENVYKTIXEqFNPSLRNFIAXGKNYEKALAGVTYAAKGYFDALVKXGELAsesq-gskeLGDVLFQXAEVHRQ 85   human
NP_001097583    4 EEVTKLVDGVYRNILDrFNPGARQLIAAGKSYLKALHGAATASRLFNEALAKIAMNAqqsg--tgdIGSALMSVVNVNKE 81   fruit fly
XP_785898       5 EQLHRMTENVYRHTIDgFNPELRNLVTLGRAYEKALQSVSQAAKDYFNAIVAVGELAsetk-dsrqLGQSLLQIAETYRQ 83   purple urchin
NP_061330       6 EEVNRLTESTYRNVMEqFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGEIAtgsp-vsteLGHVLIEISSTHKK 84   human
XP_002109546    2 DIPDTYDIYIFWNVNEkVHPALRELLIASRGYQKAQQELDKAHNVFVDCLAKIERMAktssgpskeIGDAIGGIVDYYKE 81   Trichoplax ad...
NP_079321       6 DQFYRSTMAIYKSIMEqFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERAlqsp-tsqiLGEILVQMSDTQRH 84   human
XP_001743935   13 DSLQALIEQTFANLKV-GTPVLDDLQKAATKYQAAMVQANMAALTFIDSLSKVAVSAsrargatqeLGQVMQKLVTQHHS 91   Monosiga brev...
XP_643938     526 KNINLLLREFRKNLKVnSPPLFTEVIKAANKYQQQAQALSQAGLVLADTLTRLTIHNgg------dFGEGFKKLADAIKD 599  Dictyostelium...
Feature 1         #                                                                               
2D1L_A         92 IEAKLRQFSSALIDCLINPLQEQXEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKlqkkakkvdaqgrgdiqpQLDS 171  house mouse
1Y2O_A         86 IQNQLEEXLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKlrkksqgs--knpqkysdKELQ 163  human
NP_001097583   82 IQDQQMNILKAFYVDLLVPLETNLEKDTKVVQHEQKKFLQQHKVRMESYQKAVSTMKKqrkkka------tpenteKELR 155  fruit fly
XP_785898      84 IETEREITVHALRKELLHPLEGKLEQEWKTVLQVQKSYLSENKAKSEAVDKCRSEVKKlqkktqkn---hsekyieKEQR 160  purple urchin
NP_061330      85 LNESLDENFKKFHKEIIHELEKKIELDVKYMNATLKRYQTEHKNKLESLEKSQAELKKirrksqgs--rnalkyehKEIE 162  human
XP_002109546   82 SEKSKQQLSKAFYGEYILPLETTLEAQIHNITKINKVFSSNFKAKCDGLDKARGELKKvkrksqgkk-gitgkyeeKVND 160  Trichoplax ad...
NP_079321      85 LNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSELWRmerk-----------rdkNVRE 153  human
XP_001743935   92 IVASREAQAGKLNSQLILPLQKRLKSEAKKLPKMEEDFKNGAKQLRSDLKRAGQSTIKaqksvrkr---gtdkeqsGLDQ 168  Monosiga brev...
XP_643938     600 LENRRDDVAKVLLNEFITPNKQAIEDDQKAIATFEKNYKKDRDQMRQDILKLEAKTRKagkk----------ttpeVLKQ 669  Dictyostelium...
Feature 1                             #  ## ##  ## ##  ##  #  ##   #  #  #      ## ##
2D1L_A        172 ALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISXLRPVIEEEIS-XLGEITHLQTISEDLKSLT 237  house mouse
1Y2O_A        164 YIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAyHSKGKELLAQKLPLWQQAC 230  human
NP_001097583  156 SLQLLEDQKKKLDVFCDQSYKNAMTQERRRYGFVLERQCSIAKHWMVyHTTGKTVIDNNFENWQEIA 222  fruit fly
XP_785898     161 TAEELQLLTKQLHNFRSNGLREAWTEERRRYCYLVDRYCSLIKNNAAfFSKAQSVLHHRLPKWNESC 227  purple urchin
NP_061330     163 YVETVTSRQSEIQKFIADGCKEALLEEKRRFCFLVDKHCGFANHIHYyHLQSAELLNSKLPRWQETC 229  human
XP_002109546  161 CEAEYNKKQNELEAYTVLEFERALNEERKRYCMVLDYTCEALSRESTnYAKNHNFLKDRIPAWRALF 227  Trichoplax adhaerens
NP_079321     154 MKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQfFGRARGMLQNRVLLWKEQS 220  human
XP_001743935  169 ATEIHTHRARTLEAFHQATLRDILIEERRRYAYLVDNWCSVFDLDFRqSEDLMRLLSEAIALTAHAD 235  Monosiga brevicollis MX1
XP_643938     670 QITELNDKIKESEQLNANKLRDVVLMERRKHATFLSQFNQFLEKEIElSADTMSKFSTNLNTHRDLI 736  Dictyostelium discoideum AX4

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap