Conserved Protein Domain Family
BAR_ASAPs

?
cd07604: BAR_ASAPs 
The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. This subfamily is composed of ASAPs (ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins), which are Arf GTPase activating proteins (GAPs) with similarity to ACAPs (ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins) in that they contain an N-terminal BAR domain, followed by a Pleckstrin homology (PH) domain, an Arf GAP domain, and ankyrin (ANK) repeats. However, ASAPs contain an additional C-terminal SH3 domain. ASAPs function in regulating cell growth, migration, and invasion. Vertebrates contain at least three members, ASAP1, ASAP2, and ASAP3. ASAP1 and ASAP2 shows GTPase activating protein (GAP) activity towards Arf1 and Arf5. They do not show GAP activity towards Arf6, but is able to mediate Arf6 signaling by binding stably to GTP-Arf6. ASAP3 is an Arf6-specific GAP. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. The BAR domain of ASAP1 mediates membrane bending, is essential for function, and autoinhibits GAP activity by interacting with the PH and/or Arf GAP domains.
Statistics
?
PSSM-Id: 153288
View PSSM: cd07604
Aligned: 11 rows
Threshold Bit Score: 275.831
Threshold Setting Gi: 170575668
Created: 8-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  #  ##   # ##  ## ##         ## ##  ## ##  #                   #  ##    
Q9ULH1         54 RNTVTLLEEALDQDRTALQKVKKSVKAIYNSGqdhvQNEENYAQVLDKFGSNflsrdnp----dlgtafvKFSTLTKELS 129  human
XP_968310      34 KNTISQLEETLDCDRDGLTKMRKAIKAIHTSGhahvENEFSLSKALEKLGSKdredvi-------geafdKFSVVTNQLS 106  red flour beetle
EEC13861       34 RQSVNLLEETLDFDRDGLTKMKKAVKAVYNSGnthvDNEVYLSKALERLGANavtkdqeq---digaaflKFSVVTKELS 110  black-legged ...
XP_783031      34 RNVVSALEETLDTDRSGLNKMRKSIKAIYNTGntyvGNLLSFSENLEKLGSNsltrerep---dlgaaflKFSVVTKELA 110  purple urchin
NP_001014504   35 RHTIGVLEERLEFDREGLTKLKKAVKAIHNSGnthvDNEMFMVRALERLGGKvieqdep----digaaflKFSVVTKELS 110  fruit fly
NP_001041455   34 RATIAALEEASPIFLSAXKKMKNSTKAMYNSGlaqvSNEANFIENLEKLGAGalynakepe-pdigsaflKLAVFTKELS 112  Ciona intesti...
XP_001626278   34 RNTVNILEESLDSDKTVLSKLKKSMKALHGAGlshvANQVAQAESLDKLGSQalsreadt---gigttflKFSVMMKELS 110  starlet sea a...
XP_002114206   36 RYVVGGIEESLELDQINLQKLKKYCKSLVSNItdysAGQLQLADYLDKLGSQtiskeae-----mgaafiNFAKLQKELA 110  Trichoplax ad...
XP_001893333   41 RVEAQRIVEETEGYTVDFERLRKASKEVEDTLvilvRQLLAFGQAAKEIATKwtsrsesqyesdvavilmKMECHIKDEA 120  agent of lymp...
NP_001128663   34 RNTVAAIEEALDVDRMVLYKMKKSVKAINSSGlahvENEEQYTQALEKFGGNcvcrddp----dlgsaflKFSVFTKELT 109  human
NP_001137250   35 RGAALAREEILEGDQAILQRIKKAVRAIHSSGlghvENEEQYREAVESLGNShlsqnsh----elstgflNLAVFTREVA 110  human
Feature 1                                                                                         
Q9ULH1        130 TLLKNLLQGLSHNVIFTLDSLLkg-------dLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHakqhgmirteitgae 202  human
XP_968310     107 LLKKTLMQNLNNIVMFPLDNLLkg-------dLRGIKGDLKRPFDKASKDYDSKYAKIEKEKKQQakeaglirseitaae 179  red flour beetle
EEC13861      111 ALMKTLMQSLHNIIMFPLDNLLkg-------dLRGVKGDLKRPFDKASRDYEAKSTKIEKEKKQQakeaglirteisaae 183  black-legged ...
XP_783031     111 ALLKNLVQNINNIIMFPLDSLLkg-------dLKGQKGDLKKPFEKAWKDYESKYSKIEREKKQQakdaglirqvvsgpe 183  purple urchin
NP_001014504  111 ALMKTLMQNINNIVMFPVDSMLks-------eLRGVKGDMKRPFDKAAKDYEAKFIKIEKEKKAQakeagmvrteidaav 183  fruit fly
NP_001041455  113 SLFKNLVSNISNIIMFPLESLLkg-------dLKGIKGDMKRPFDKSWKDYDTKVKQVEREKRQLakdagmirneitgae 185  Ciona intesti...
XP_001626278  111 SLMKVLYTNYYNMIMFPLDSLLkg-------dLKDIKGELRKPFDKAWKDYETKCSKIEKEKKKIaqeaglirtevagse 183  starlet sea a...
XP_002114206  111 ALSKRLVHSHSNLASLQNDGHAks-------gGKNSKLELKKAVEAIEKLIKDYDSKRNERRKLDsdrq---------he 174  Trichoplax ad...
XP_001893333  121 DLTNLQMRNWQSNIVTPFLTLVeigreirnrgVERSCRDYENKYVKAEADARKHAKHAGYTRSQLghg-----------e 189  agent of lymp...
NP_001128663  110 ALFKNLIQNMNNIISFPLDSLLkg-------dLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHaklhgmirteisgae 182  human
NP_001137250  111 ALFKNLIQNLNNIVSFPLDSLMkg-------qLRDGRQASLSLGSRAKLEKERDRARVTGGIPGEv-------------- 169  human
Feature 1                                #  ## # #  ## ##     ##  ## ##  ## ##      
Q9ULH1        203 iAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCSFFQDGLKTADKLKQYIEKL 268  human
XP_968310     180 iADEMEKERRLFQLQMCEYLIKYNEIKTKKGIDLLQNLVEYYHAQINYFQDGLKTIQHFGFYVADL 245  red flour beetle
EEC13861      184 iADEMEKERKMFQLQMCEYLLKVNEIKTKKGVELLQHLVEFYHAQNNFFQDGLKTIGHFNNYIIEL 249  black-legged tick
XP_783031     184 vAEEMEKERRMFQLQMCEYLFKVNEIKAKKGAELVQHLVEYYRAENSYFRDGLKTVEHFQSYIDEL 249  purple urchin
NP_001014504  184 vAEEMEKERRLYQLQTCEYLLKYKDIKTKTGIELLQHLIEYYHALSNYFKDGLQTIEHFGTYIGDL 249  fruit fly
NP_001041455  186 iAEEMEKERRMFQLQMCDYLIKANEIKTKKGVDLLQHLVEFYHAQNTFFTDGYKVIEHFRAYAEDL 251  Ciona intestinalis
XP_001626278  184 mAEETERERRVFQLQMCELLIKVNEIQVKKGVDVAQHLVEFYHAQIQYFQESLQVLDGLRGYVEEL 249  starlet sea anemone
XP_002114206  175 sAESDSDSKRHLQMQLCDYFIKVNDAKLKQRIEFVQRLVDYYHSQVSYFQEGFAMLEGFKPYIQEL 240  Trichoplax adhaerens
XP_001893333  190 lAEQLTRERLMVQYELCKFLMSVDTVEDRRGPQLLRHFMELVRNQNSYYMNRVRVNEDFRQDMTKL 255  agent of lymphatic filariasis
NP_001128663  183 iAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVESLKPSIETL 248  human
NP_001137250  170 -AQDMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFIEKL 234  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap