Conserved Protein Domain Family
BAR_Rvs167p

?
cd07599: BAR_Rvs167p 
The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 167 and similar proteins
BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. This subfamily is composed of fungal proteins with similarity to Saccharomyces cerevisiae Reduced viability upon starvation protein 167 (Rvs167p) and Schizosaccharomyces pombe Hob1 (homolog of Bin1). S. cerevisiae Rvs167p plays a role in regulation of the actin cytoskeleton, endocytosis, and sporulation. It forms a heterodimer with another BAR domain protein Rvs161p. Rvs161p and Rvs167p share common functions but are not interchangeable. Their BAR domains cannot be replaced with each other and the overexpression of one cannot suppress the mutant phenotypes of the other. Rvs167p also interacts with the GTPase activating protein (GAP) Gyp5p, which is involved in ER to Golgi vesicle trafficking. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions.
Statistics
?
PSSM-Id: 153283
View PSSM: cd07599
Aligned: 29 rows
Threshold Bit Score: 154.72
Threshold Setting Gi: 150866163
Created: 8-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
dimer interface
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 #  ##   # ##  ## ##                                            ## ##  #
P39743        29 DPVYEDAERRFQELEQETKKLSEESKRYSTavng-----------------------------------mltHQIGFAKS 73  baker's yeast
XP_451750     38 DKFVEDLKSRFEAIHGCSSRLVKDCNKFENntra-----------------------------------lleHFERSIEI 82  Kluyveromyces l...
XP_001383104  58 DEEFNYLEKQFKETEKTLQSVEKYVKMYSKstlt-----------------------------------lldRSTAVGKG 102 Pichia stipitis...
CAX45133      55 DQTFNELDEELIAIEASIKKLSKYAKVFGEsmnq-----------------------------------ilsNSVGSAES 99  Candida dublini...
NP_984999     42 DKSFDVIQETFNHIHNSVLTLDTECTRFSTqitn-----------------------------------lmnHTQNLNRG 86  Ashbya gossypii...
CAG85330      65 DEGFDELESNLLYIEKKLNCLIKYTSGYCSgilk-----------------------------------vltHSKNIGLF 109 Debaryomyces ha...
XP_001528140  57 DEDFDKLENILKSQSVSLKKLIEQTKQFTSsmvd-----------------------------------tiqNAIAVSKC 101 Lodderomyces el...
XP_001644465  42 DLQFNELATKFNSTRMHIRSLHEACKRYKLtlhsffyssvsvlevfhklldgvpmechmnpdgtaqmvtnniSAKQRASE 121 Vanderwaltozyma...
CAC09437       1 DPQFTELHFKFNFLVSNIESLLHACEQYKRsl--------------------------------------ryFFSESIKM 42  Zygosaccharomyc...
XP_002172401  31 DAQVNEWERQVTSLNMSIRALIENARLFRDswrcv--------------------------------vctgpSLIAAWIA 78  Schizosaccharom...
Feature 1        # ##  #                                                      #  ##              
P39743        74 MEEIFKPISGkmsdpnatipe-----------------------------dnpqgieaseQYRAIVAELQETLKPDLALV 124 baker's yeast
XP_451750     83 FGNIYDVKFTedeir-----------------------------------------rdftSLSKRFKIIKDKIEADLPIF 121 Kluyveromyces l...
XP_001383104 103 YSLLYDPYEDlakktgeqsnsqv-------------------------fedqyrkwqnvnNYIETINMCKSEIENETKTL 157 Pichia stipitis...
CAX45133     100 FQNLIDPYTNlkndsqild---------------------------------daytawskITKYKHKVKDIFVETEIDHL 146 Candida dublini...
NP_984999     87 FQEIISRGAWdniqvgspvspnsvmspvg-------------rdfspavatpttkrfnfsKYVDRFQTTIVKIKSDQQQF 153 Ashbya gossypii...
CAG85330     110 LQQLFDPYNTlpdsiktkleanrnfdsqnesi-------fssasrqcifreeyeiwsncaSYVECTKTIEPSIKNEIEIL 182 Debaryomyces ha...
XP_001528140 102 FHDTIDPCSNahsnvpif----------------------------------gdtydkwaNMVKYKQLVQAISIESEIVY 147 Lodderomyces el...
XP_001644465 122 FLQEFYSIAGiehigq--------------------------------------kkidisRLNKQLQVVSKKVEQDLEFF 163 Vanderwaltozyma...
CAC09437      43 LETFHQVLDErdivspsspvnspytnsnssegpirgsqpsppfrewgktsddycsipnigRLQRQMIVIVRRAEQDLLFF 122 Zygosaccharomyc...
XP_002172401  79 LYRQIPPEKSlaasv-----------------------------------------gtlvEWNKALESQRREVLLLLQPF 117 Schizosaccharom...
Feature 1                                                                                        
P39743       125 EEKIVTPCQELLk--IITYIRKMATKRNHKKLDLDRHLNTynk-------heKKKEPTAKDEERLYkaQAQVEVAQQEYD 195 baker's yeast
XP_451750    122 EHNVIEPIQAFHt--TCGNIQNTIDKRDLASYKVDSLRHKltgl-----tpqKLRTPGLKYENEKIkiEGKYDKALKVYE 194 Kluyveromyces l...
XP_001383104 158 AAMVESKIQEIYs--NINNIHKKIRVRSYALVDYDKVYNShdnl----llkqKSGELTVKQSQQLFssERKLEENKVKFD 231 Pichia stipitis...
CAX45133     147 VSSVEKKLSEICk--IYNAVFKKIELRKTALLDYDKVYNDhesl----llkqEQSELTLKQNNQLYslERKLEDTKTRYT 220 Candida dublini...
NP_984999    154 QTRVVLPLLQLKd--LGLRIQKPLEERRNLVLDINSYSSKveky----nqrvHTNELTLKGEQKRMkyDKKLEDVRFKYE 227 Ashbya gossypii...
CAG85330     183 GAMVEVRVSEMLs--LISFIKKHIRNRNYALMDYDKTYNAhesl----alrhKTDELSIKQSQQMHnlERKLEGNKVIYT 256 Debaryomyces ha...
XP_001528140 148 LNNGTLKQLELLnnqILKQVFKMIRERRYAALDCDKLSNEhktlaekqsnigGADQLSSRETSHIFaiGRKLFDAKKKYN 227 Lodderomyces el...
XP_001644465 164 DLHVLQPLVEVDl--LCSKTSRYIDYRDLKNLEVSSLNDKcdslk--kltnnNTKTLTSKQEVERMrsEKKLKTISEDFE 239 Vanderwaltozyma...
CAC09437     123 EKSVQGPLAQLIm--ISRNVTRTISRRGAANAEWGQLATRhhdl----lrnrALGKKTVNRQQEEAsvIKKLQTSLEKFD 196 Zygosaccharomyc...
XP_002172401 118 DYSILAPCKEVKh--YMKKADELVQKRTRKKAEFDKLQKDlls-------lyELHEPESQRHKLKSf-RSSLQRVNKELD 187 Schizosaccharom...
Feature 1                  #  ## #    #  ## ##  ##  ## ##  ## ##   
P39743       196 YYNDLLKTQLPILFSLEAEFVKPLFVSFYFMQLNIFYTLYNRLQDMKIPY 245 baker's yeast
XP_451750    195 PLNEQLRSELGIFLQMTNKFFQDWFLNHYYITYSFYYNMYTFIGTCSEVR 244 Kluyveromyces lactis NRRL Y-1140
XP_001383104 232 EINDLLKKELPYFLKLVELILTPLQEYVYYVQLMNYFQFSSRCKSYANFI 281 Pichia stipitis CBS 6054
CAX45133     221 RINSLLVRELPLLICFTQEAMGYVQAHIYYVHLTFCYQVSERIKEHDLIE 270 Candida dubliniensis CD36
NP_984999    228 ALNSILKVELQVYFDLFRDFLSAWFPLYLYITYSLYYNLYQFLGNCPEVR 277 Ashbya gossypii ATCC 10895
CAG85330     257 DLNGLLKKELPFFFKLVDSILQPIQLRTYYVQLLVSYQININLLSIQDIF 306 Debaryomyces hansenii
XP_001528140 228 YYNALLKKELPSLILLIKPIISYATTDLYLLHLNYCYSWIIKLNNIPYKD 277 Lodderomyces elongisporus NRRL YB-4239
XP_001644465 240 LINNKLKNELPIFFDSINTFLQNWFSTYYFTTLRISYALYTYTSNSPELK 289 Vanderwaltozyma polyspora DSM 70294
CAC09437     197 ALNELCKDGLVKFLSLSSQLLEEWFHNYYYTNLRISYALHHFSWNVPEFR 246 Zygosaccharomyces rouxii
XP_002172401 188 ELNRVLAKNIPAIISKSRTLFQHLLKRFYKTHFQIARKMFIAVRPWDCFQ 237 Schizosaccharomyces japonicus yFS275

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap